Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23610_WB10.jpg WB (Western Blot) (WB Suggested Anti-CTNNB1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit CTNNB1 Polyclonal Antibody | anti-CTNNB1 antibody

CTNNB1 antibody - C-terminal region

Gene Names
CTNNB1; EVR7; CTNNB; MRD19; armadillo
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
CTNNB1, Antibody; CTNNB1 antibody - C-terminal region; anti-CTNNB1 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Sequence Length
694
Applicable Applications for anti-CTNNB1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CTNNB1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA23610_WB10.jpg WB (Western Blot) (WB Suggested Anti-CTNNB1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Sample Type : HCT116 cell lysateCTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116)

product-image-AAA23610_WB9.jpg WB (Western Blot) (Sample Type : HCT116 cell lysateCTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116)

WB (Western Blot)

(Host: RabbitTarget Name: CTNNB1Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

product-image-AAA23610_WB8.jpg WB (Western Blot) (Host: RabbitTarget Name: CTNNB1Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CTNNB1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA23610_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: CTNNB1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CTNNB1Sample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

product-image-AAA23610_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: CTNNB1Sample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: CTNNB1Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

product-image-AAA23610_WB5.jpg WB (Western Blot) (Host: MouseTarget Name: CTNNB1Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: CTNNB1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA23610_WB4.jpg WB (Western Blot) (Host: MouseTarget Name: CTNNB1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-CTNNB1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: Cytoplasm, Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA23610_IHC3.jpg IHC (Immunohistochemistry) (Rabbit Anti-CTNNB1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: Cytoplasm, Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Rabbit Anti-CTNNB1 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23610_IHC2.jpg IHC (Immunohistochemistry) (Rabbit Anti-CTNNB1 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Human Intestine)

product-image-AAA23610_IHC.jpg IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-CTNNB1 antibody
This is a rabbit polyclonal antibody against CTNNB1. It was validated on Western Blot and immunohistochemistry

Target Description: CTNNB1 is involved in the regulation of cell adhesion and in signal transduction through the Wnt pathway.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
76kDa
NCBI Official Synonym Full Names
catenin beta 1
NCBI Official Symbol
CTNNB1
NCBI Official Synonym Symbols
EVR7; CTNNB; MRD19; armadillo
NCBI Protein Information
catenin beta-1

Similar Products

Product Notes

The CTNNB1 (Catalog #AAA23610) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTNNB1 antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CTNNB1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CTNNB1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPMMEHEMGG HHPGADYPVD GLPDLGHAQD LMDGLPPGDS NQLAWFDTDL. It is sometimes possible for the material contained within the vial of "CTNNB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.