Rabbit Ctp Synthase Polyclonal Antibody | anti-pyrG antibody
Ctp Synthase antibody
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
Ctp Synthase, Antibody; Ctp Synthase antibody; Polyclonal Ctp Synthase; Anti-Ctp Synthase; CTPS; anti-pyrG antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Ctp Synthase antibody was raised against the N terminal of CTPS
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CTPS antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
542
Applicable Applications for anti-pyrG antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development and tumorigenesis.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-pyrG antibody
Rabbit polyclonal Ctp Synthase antibody raised against the N terminal of CTPS
Product Categories/Family for anti-pyrG antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
67 kDa (MW of target protein)
NCBI Official Full Name
CTP synthase
UniProt Protein Name
CTP synthase
UniProt Gene Name
pyrG
UniProt Entry Name
M1E733_9FIRM
Similar Products
Product Notes
The Ctp Synthase pyrg (Catalog #AAA224402) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ctp Synthase antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ctp Synthase can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Ctp Synthase pyrg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ctp Synthase, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
