Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-CTRC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Rabbit CTRC Polyclonal Antibody | anti-CTRC antibody

CTRC antibody - N-terminal region

Gene Names
CTRC; CLCR; ELA4
Reactivity
Tested Species Reactivity: Human!!Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CTRC, Antibody; CTRC antibody - N-terminal region; anti-CTRC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivity: Human!!Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK
Sequence Length
268
Applicable Applications for anti-CTRC antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CTRC
Protein Size (# AA)
268 amino acids
Protein Interactions
KRTAP10-3; KRTAP10-7; UBC; ST13; NEDD8; PHKG1; SPINK1; SERPINA3;
Blocking Peptide
For anti-CTRC (AAA23430) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CTRC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

WB (Western Blot) (WB Suggested Anti-CTRC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-CTRC antibody
Target Description: CTRC is a member of the peptidase S1 family. The protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Product Categories/Family for anti-CTRC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
chymotrypsin-C preproprotein
NCBI Official Synonym Full Names
chymotrypsin C
NCBI Official Symbol
CTRC
NCBI Official Synonym Symbols
CLCR; ELA4
NCBI Protein Information
chymotrypsin-C
UniProt Protein Name
Chymotrypsin-C
UniProt Gene Name
CTRC
UniProt Synonym Gene Names
CLCR
UniProt Entry Name
CTRC_HUMAN

Similar Products

Product Notes

The CTRC ctrc (Catalog #AAA23430) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTRC antibody - N-terminal region reacts with Tested Species Reactivity: Human!!Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CTRC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTRC ctrc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGITVLAALL ACASSCGVPS FPPNLSARVV GGEDARPHSW PWQISLQYLK. It is sometimes possible for the material contained within the vial of "CTRC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.