IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using CTSD antibody.)
Rabbit anti-Human, Mouse CTSD Polyclonal Antibody | anti-CTSD antibody
CTSD Polyclonal Antibody
Gene Names
CTSD; CPSD; CLN10; HEL-S-130P
Reactivity
Human, Mouse
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
CTSD, Antibody; CTSD Polyclonal Antibody; CLN10; CPSD; HEL-S-130P; anti-CTSD antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
GPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVP
Sequence Length
412
Applicable Applications for anti-CTSD antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human CTSD
Immunogen Species
Human
Cellular Location
Lysosome, Melanosome, Secreted, extracellular space
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using CTSD antibody.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using CTSD antibody.)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded human liver cancer using CTSD antibody at dilution of 1:100 (40x lens).)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded human liver cancer using CTSD antibody at dilution of 1:100 (40x lens).)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using CTSD antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using CTSD antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-CTSD antibody
This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease.
Product Categories/Family for anti-CTSD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 44kDa
Observed: 45kDa
Observed: 45kDa
NCBI Official Full Name
cathepsin D preproprotein
NCBI Official Synonym Full Names
cathepsin D
NCBI Official Symbol
CTSD
NCBI Official Synonym Symbols
CPSD; CLN10; HEL-S-130P
NCBI Protein Information
cathepsin D
UniProt Protein Name
Cathepsin D
UniProt Gene Name
CTSD
UniProt Synonym Gene Names
CPSD
Similar Products
Product Notes
The CTSD ctsd (Catalog #AAA281002) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTSD Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CTSD can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CTSD ctsd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GPIPEVLKNY MDAQYYGEIG IGTPPQCFTV VFDTGSSNLW VPSIHCKLLD IACWIHHKYN SDKSSTYVKN GTSFDIHYGS GSLSGYLSQD TVSVPCQSAS SASALGGVKV ERQVFGEATK QPGITFIAAK FDGILGMAYP RISVNNVLPV FDNLMQQKLV DQNIFSFYLS RDPDAQPGGE LMLGGTDSKY YKGSLSYLNV TRKAYWQVHL DQVEVASGLT LCKEGCEAIV DTGTSLMVGP VDEVRELQKA IGAVP. It is sometimes possible for the material contained within the vial of "CTSD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.