Rabbit CTTNBP2 Polyclonal Antibody | anti-CTTNBP2 antibody
CTTNBP2 Antibody - C-terminal region
Gene Names
CTTNBP2; Orf4; C7orf8; CORTBP2
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CTTNBP2, Antibody; CTTNBP2 Antibody - C-terminal region; anti-CTTNBP2 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: NANDPDQNGNTTQSPPSRDVSPTSRDNLVAKQLARNTVTQALSRFTSPQA
Sequence Length
640
Applicable Applications for anti-CTTNBP2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human CTTNBP2
Tissue Tool
Find tissues and cell lines supported by DNA array analysis to express CTTNBP2.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-CTTNBP2 antibody
Target Description: This gene encodes a protein with six ankyrin repeats and several proline-rich regions. A similar gene in rat interacts with a central regulator of the actin cytoskeleton.
Product Categories/Family for anti-CTTNBP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
cortactin-binding protein 2 isoform 1
NCBI Official Synonym Full Names
cortactin binding protein 2
NCBI Official Symbol
CTTNBP2
NCBI Official Synonym Symbols
Orf4; C7orf8; CORTBP2
NCBI Protein Information
cortactin-binding protein 2
UniProt Protein Name
Cortactin-binding protein 2
UniProt Gene Name
CTTNBP2
UniProt Synonym Gene Names
C7orf8; CORTBP2; KIAA1758; CortBP2
UniProt Entry Name
CTTB2_HUMAN
Similar Products
Product Notes
The CTTNBP2 cttnbp2 (Catalog #AAA201489) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTTNBP2 Antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CTTNBP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CTTNBP2 cttnbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NANDPDQNGN TTQSPPSRDV SPTSRDNLVA KQLARNTVTQ ALSRFTSPQA. It is sometimes possible for the material contained within the vial of "CTTNBP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
