Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23543_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CYP11A1 Polyclonal Antibody | anti-CYP11A1 antibody

CYP11A1 antibody - middle region

Gene Names
CYP11A1; CYP11A; CYPXIA1; P450SCC
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CYP11A1, Antibody; CYP11A1 antibody - middle region; anti-CYP11A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW
Sequence Length
521
Applicable Applications for anti-CYP11A1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYP11A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23543_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlCYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA23543_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlCYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(CYP11A1 antibody - middle region validated by WB using Hela cell lysate at 1ug/ml.CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA23543_WB5.jpg WB (Western Blot) (CYP11A1 antibody - middle region validated by WB using Hela cell lysate at 1ug/ml.CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0ug/ml using anti-CYP11A1 antibody)

product-image-AAA23543_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0ug/ml using anti-CYP11A1 antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry with HK2 cell lysate tissue)

product-image-AAA23543_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry with HK2 cell lysate tissue)

IHC (Immunohistochemistry)

(Immunohistochemistry with HK2 cell lysate tissue)

product-image-AAA23543_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry with HK2 cell lysate tissue)

IHC (Immunohistochemistry)

(Immunohistochemistry with HK2 cell lysate tissue)

product-image-AAA23543_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry with HK2 cell lysate tissue)
Related Product Information for anti-CYP11A1 antibody
This is a rabbit polyclonal antibody against CYP11A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CYP11A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP11A1 localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
cholesterol side-chain cleavage enzyme, mitochondrial isoform a
NCBI Official Synonym Full Names
cytochrome P450 family 11 subfamily A member 1
NCBI Official Symbol
CYP11A1
NCBI Official Synonym Symbols
CYP11A; CYPXIA1; P450SCC
NCBI Protein Information
cholesterol side-chain cleavage enzyme, mitochondrial
UniProt Protein Name
Cholesterol side-chain cleavage enzyme, mitochondrial
UniProt Gene Name
CYP11A1
UniProt Synonym Gene Names
CYP11A
UniProt Entry Name
CP11A_HUMAN

Similar Products

Product Notes

The CYP11A1 cyp11a1 (Catalog #AAA23543) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP11A1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP11A1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CYP11A1 cyp11a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRQKGSVHHD YRGILYRLLG DSKMSFEDIK ANVTEMLAGG VDTTSMTLQW. It is sometimes possible for the material contained within the vial of "CYP11A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.