Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198893_WB10.jpg WB (Western Blot) (WB Suggested Anti-CYP1A1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)

Rabbit CYP1A1 Polyclonal Antibody | anti-CYP1A1 antibody

CYP1A1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
CYP1A1; AHH; AHRR; CP11; CYP1; CYPIA1; P1-450; P450-C; P450DX
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYP1A1, Antibody; CYP1A1 antibody - middle region; anti-CYP1A1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV
Sequence Length
512
Applicable Applications for anti-CYP1A1 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 83%; Goat: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CYP1A1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)

product-image-AAA198893_WB10.jpg WB (Western Blot) (WB Suggested Anti-CYP1A1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)

WB (Western Blot)

(Lanes:Lane 1: Human lung microsome lysateLane 2-5: 150 ug mouse lung microsome lysatePrimary Antibody Dilution:1: 1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1: 10000Gene Name:CYP1A1Submitted by:Jing Peng, Fox Chase Cancer Center)

product-image-AAA198893_WB11.jpg WB (Western Blot) (Lanes:Lane 1: Human lung microsome lysateLane 2-5: 150 ug mouse lung microsome lysatePrimary Antibody Dilution:1: 1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1: 10000Gene Name:CYP1A1Submitted by:Jing Peng, Fox Chase Cancer Center)

WB (Western Blot)

(Host: RabbitTarget Name: CYP1A1Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA198893_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CYP1A1Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: CYP1A1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA198893_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: CYP1A1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-CYP1A1 antibody
This is a rabbit polyclonal antibody against CYP1A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
cytochrome P450 1A1 isoform 1
NCBI Official Synonym Full Names
cytochrome P450 family 1 subfamily A member 1
NCBI Official Symbol
CYP1A1
NCBI Official Synonym Symbols
AHH; AHRR; CP11; CYP1; CYPIA1; P1-450; P450-C; P450DX
NCBI Protein Information
cytochrome P450 1A1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CYP1A1 (Catalog #AAA198893) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP1A1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CYP1A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CYP1A1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLSDEKIINI VLDLFGAGFD TVTTAISWSL MYLVMNPRVQ RKIQEELDTV. It is sometimes possible for the material contained within the vial of "CYP1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.