Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201632_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CYP2C70Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)

Rabbit CYP2C70 Polyclonal Antibody | anti-CYP2C70 antibody

CYP2C70 Antibody - middle region

Reactivity
Tested Reactivity: Mouse
Predicted Reactivity: Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CYP2C70, Antibody; CYP2C70 Antibody - middle region; anti-CYP2C70 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Mouse
Predicted Reactivity: Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
RGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKKSDYFV
Applicable Applications for anti-CYP2C70 antibody
WB (Western Blot)
Protein Size (# AA)
489 amino acids
Blocking Peptide
For anti-CYP2C70 (MBS3223844) antibody is Catalog # ( )
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse CYP2C70
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: CYP2C70Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201632_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CYP2C70Sample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CYP2C70 antibody
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Product Categories/Family for anti-CYP2C70 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56 kDa
NCBI Official Full Name
cytochrome P450 2C70
NCBI Official Synonym Full Names
cytochrome P450, family 2, subfamily c, polypeptide 70
NCBI Official Symbol
Cyp2c70
NCBI Protein Information
cytochrome P450 2C70
UniProt Protein Name
Cytochrome P450 2C70
UniProt Gene Name
Cyp2c70

Similar Products

Product Notes

The CYP2C70 cyp2c70 (Catalog #AAA201632) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP2C70 Antibody - middle region reacts with Tested Reactivity: Mouse Predicted Reactivity: Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CYP2C70 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CYP2C70 cyp2c70 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RGYHIPKGTS VMACLTSVLN DDKEFPNPEK FDPGHFLDEK GNFKKSDYFV. It is sometimes possible for the material contained within the vial of "CYP2C70, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.