WB (Western Blot)
(WB Suggested Anti-DACH2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Rabbit DACH2 Polyclonal Antibody | anti-DACH2 antibody
DACH2 antibody - C-terminal region
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DACH2, Antibody; DACH2 antibody - C-terminal region; anti-DACH2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG
Sequence Length
599
Applicable Applications for anti-DACH2 antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DACH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-DACH2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-DACH2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(Host: MouseTarget Name: DACH2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: DACH2Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
Related Product Information for anti-DACH2 antibody
This is a rabbit polyclonal antibody against DACH2. It was validated on Western Blot and immunohistochemistry
Target Description: Most X autosome translocations associated with premature ovarian failure do not interrupt X-linked genes. Only one of the six breakpoints disrupts the DACH2 gene.
Target Description: Most X autosome translocations associated with premature ovarian failure do not interrupt X-linked genes. Only one of the six breakpoints disrupts the DACH2 gene.
Product Categories/Family for anti-DACH2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
dachshund homolog 2 isoform b
NCBI Official Synonym Full Names
dachshund family transcription factor 2
NCBI Official Symbol
DACH2
NCBI Protein Information
dachshund homolog 2
UniProt Protein Name
Dachshund homolog 2
UniProt Gene Name
DACH2
UniProt Synonym Gene Names
Dach2
UniProt Entry Name
DACH2_HUMAN
Similar Products
Product Notes
The DACH2 dach2 (Catalog #AAA197361) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DACH2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DACH2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DACH2 dach2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TKRKLQEALE FESKRREQVE QALKQATTSD SGLRMLKDTG IPDIEIENNG. It is sometimes possible for the material contained within the vial of "DACH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.