Rabbit DBP Polyclonal Antibody | anti-DBP antibody
DBP antibody - C-terminal region
Gene Names
DBP; DABP; taxREB302
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DBP, Antibody; DBP antibody - C-terminal region; anti-DBP antibody
Host
Rabbit
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Applicable Applications for anti-DBP antibody
WB (Western Blot)
Protein Size (# AA)
325 amino acids
Official Gene Full Name
D site of albumin promoter (albumin D-box) binding protein
Peptide Sequence
Synthetic peptide located within the following region: FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK
Protein Interactions
BATF2; BATF3; BATF; EPAS1; DDIT3; CEBPG; CEBPA; ATF3; HLF; EP300; TEF;
Blocking Peptide
For anti-DBP (MBS3213661) antibody is Catalog #
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DBP
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 90%; Rat: 100%; Sheep: 100%; Zebrafish: 80%
Replacement Item
This antibody may replace item sc-131142 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-DBP antibody
Target Description: DBP is a member of the PAR bZIP (proline and acidic amino acid-rich basic leucine zipper) transcription factor family. It is transcriptional activator that recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. The protein is not essential for circadian rhythm generation, but modulates important clock output genes.
Product Categories/Family for anti-DBP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
D site-binding protein
NCBI Official Synonym Full Names
D-box binding PAR bZIP transcription factor
NCBI Official Symbol
DBP
NCBI Official Synonym Symbols
DABP; taxREB302
NCBI Protein Information
D site-binding protein
UniProt Protein Name
D site-binding protein
UniProt Gene Name
DBP
UniProt Synonym Gene Names
TaxREB302
UniProt Entry Name
DBP_HUMAN
Similar Products
Product Notes
The DBP dbp (Catalog #AAA200761) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DBP antibody - C-terminal region reacts with Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DBP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DBP dbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
