Rabbit DDX6 Polyclonal Antibody | anti-DDX6 antibody
DDX6 Polyclonal Antibody
Gene Names
DDX6; P54; RCK; HLR2
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
DDX6, Antibody; DDX6 Polyclonal Antibody; DDX6; HLR2; P54; RCK; DEAD-box helicase 6; anti-DDX6 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
0.95 mg/ml (varies by lot)
Sequence Length
483
Applicable Applications for anti-DDX6 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF: 1:50-1:100
IHC: 1:50-1:100
IF: 1:50-1:100
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human DDX6 (NP_001244120.1).
Immunogen Sequence
IQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP
Positive Samples
HepG2, HeLa, NIH/3T3, Rat Spleen
Cellular Location
Cytoplasm, P-body
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-DDX6 antibody
This gene encodes a member of the DEAD box protein family. The protein is an RNA helicase found in P-bodies and stress granules, and functions in translation suppression and mRNA degradation. It is required for microRNA-induced gene silencing. Multiple alternatively spliced variants, encoding the same protein, have been identified.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 54kDa
Observed: 54kDa
Observed: 54kDa
NCBI Official Full Name
Probable ATP-dependent RNA helicase DDX6
NCBI Official Synonym Full Names
DEAD-box helicase 6
NCBI Official Symbol
DDX6
NCBI Official Synonym Symbols
P54; RCK; HLR2
NCBI Protein Information
probable ATP-dependent RNA helicase DDX6
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX6
UniProt Gene Name
DDX6
UniProt Synonym Gene Names
HLR2; RCK
UniProt Entry Name
DDX6_HUMAN
Similar Products
Product Notes
The DDX6 ddx6 (Catalog #AAA28293) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX6 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DDX6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). WB: 1:500-1:2000 IHC: 1:50-1:100 IF: 1:50-1:100. Researchers should empirically determine the suitability of the DDX6 ddx6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDX6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
