Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA28301_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry-DEPDC6 Polyclonal Antibody)

Rabbit DEPDC6 Polyclonal Antibody | anti-DEPDC6 antibody

DEPDC6 Polyclonal Antibody

Gene Names
DEPTOR; DEP.6; DEPDC6
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
DEPDC6, Antibody; DEPDC6 Polyclonal Antibody; DEPTOR; DEP.6; DEPDC6; DEP domain-containing mTOR-interacting protein; anti-DEPDC6 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
4.39 mg/ml (varies by lot)
Sequence Length
409
Applicable Applications for anti-DEPDC6 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human DEPDC6 (NP_073620.2).
Immunogen Sequence
MEEGGSTGSAGSDSSTSGSGGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKHPFVDSNLLYQFRMN
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry-DEPDC6 Polyclonal Antibody)

product-image-AAA28301_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry-DEPDC6 Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-DEPDC6 Polyclonal Antibody)

product-image-AAA28301_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry-DEPDC6 Polyclonal Antibody)

IHC (Immunohistchemistry)

(Immunohistochemistry-DEPDC6 Polyclonal Antibody)

product-image-AAA28301_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry-DEPDC6 Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-DEPDC6 Polyclonal Antibody)

product-image-AAA28301_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry-DEPDC6 Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-DEPDC6 Polyclonal Antibody)

product-image-AAA28301_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry-DEPDC6 Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-DEPDC6 Polyclonal Antibody)

product-image-AAA28301_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry-DEPDC6 Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-DEPDC6 Polyclonal Antibody)

product-image-AAA28301_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry-DEPDC6 Polyclonal Antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry-DEPDC6 Polyclonal Antibody)

product-image-AAA28301_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry-DEPDC6 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa; 46kDa
NCBI Official Full Name
DEP domain-containing mTOR-interacting protein isoform 1
NCBI Official Synonym Full Names
DEP domain containing MTOR interacting protein
NCBI Official Symbol
DEPTOR
NCBI Official Synonym Symbols
DEP.6; DEPDC6
NCBI Protein Information
DEP domain-containing mTOR-interacting protein
UniProt Protein Name
DEP domain-containing mTOR-interacting protein
UniProt Gene Name
DEPTOR
UniProt Synonym Gene Names
DEPDC6
UniProt Entry Name
DPTOR_HUMAN

Similar Products

Product Notes

The DEPDC6 deptor (Catalog #AAA28301) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DEPDC6 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DEPDC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:100. Researchers should empirically determine the suitability of the DEPDC6 deptor for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DEPDC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.