Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199611_WB13.jpg WB (Western Blot) (WB Suggested Anti-DGKH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Rabbit DGKH Polyclonal Antibody | anti-DGKH antibody

DGKH antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
DGKH; DGKeta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
DGKH, Antibody; DGKH antibody - middle region; anti-DGKH antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW
Sequence Length
1220
Applicable Applications for anti-DGKH antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DGKH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DGKH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

product-image-AAA199611_WB13.jpg WB (Western Blot) (WB Suggested Anti-DGKH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

IHC (Immunohistochemistry)

(Sample Type :Adult mouse cortexPrimary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: DGKH Cyan: Nissl (Neurons)Gene Name :DGKHSubmitted by :Joshua R. Sanes, Molecular and Cellular Biology, Harvard University, 52 Oxford Street, Room 335, Cambridge MA 02138, Phone: 617-496-8683, FAX: 617-495-0524, email: sanesj@mcb.harvard.edu)

product-image-AAA199611_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Adult mouse cortexPrimary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: DGKH Cyan: Nissl (Neurons)Gene Name :DGKHSubmitted by :Joshua R. Sanes, Molecular and Cellular Biology, Harvard University, 52 Oxford Street, Room 335, Cambridge MA 02138, Phone: 617-496-8683, FAX: 617-495-0524, email: sanesj@mcb.harvard.edu)
Related Product Information for anti-DGKH antibody
This is a rabbit polyclonal antibody against DGKH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DGKH is a member of the diacylglycerol kinase (DGK) enzyme family of proteins, specifically the type II DGK subfamily. Members of this family are involved in regulating the intracellular concentrations of diacylglycerol and phosphatidic acid. This gene encodes a member of the diacylglycerol kinase (DGK) enzyme family of proteins, specifically the type II DGK subfamily. Members of this family are involved in regulating the intracellular concentrations of diacylglycerol and phosphatidic acid. Two transcript variants encoding distinct isoforms have been identified for this gene.
Product Categories/Family for anti-DGKH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
135kDa
NCBI Official Full Name
diacylglycerol kinase eta isoform 2
NCBI Official Synonym Full Names
diacylglycerol kinase eta
NCBI Official Symbol
DGKH
NCBI Official Synonym Symbols
DGKeta
NCBI Protein Information
diacylglycerol kinase eta
UniProt Protein Name
Diacylglycerol kinase eta
UniProt Gene Name
DGKH
UniProt Synonym Gene Names
DAG kinase eta; DGK-eta
UniProt Entry Name
DGKH_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DGKH dgkh (Catalog #AAA199611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DGKH antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DGKH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the DGKH dgkh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLDSVDGYSE KCVMNNYFGI GLDAKISLEF NNKREEHPEK CRSRTKNLMW. It is sometimes possible for the material contained within the vial of "DGKH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.