Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199767_WB13.jpg WB (Western Blot) (WB Suggested Anti-DHCR24 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateDHCR24 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit DHCR24 Polyclonal Antibody | anti-DHCR24 antibody

DHCR24 antibody - N-terminal region

Gene Names
DHCR24; DCE; SELADIN1; Nbla03646; seladin-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DHCR24, Antibody; DHCR24 antibody - N-terminal region; anti-DHCR24 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK
Sequence Length
516
Applicable Applications for anti-DHCR24 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DHCR24
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DHCR24 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateDHCR24 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA199767_WB13.jpg WB (Western Blot) (WB Suggested Anti-DHCR24 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateDHCR24 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: DHCR24Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA199767_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: DHCR24Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DHCR24 antibody
This is a rabbit polyclonal antibody against DHCR24. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DHCR24 is a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells.This gene encodes a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
delta(24)-sterol reductase
NCBI Official Synonym Full Names
24-dehydrocholesterol reductase
NCBI Official Symbol
DHCR24
NCBI Official Synonym Symbols
DCE; SELADIN1; Nbla03646; seladin-1
NCBI Protein Information
delta(24)-sterol reductase
UniProt Protein Name
Delta(24)-sterol reductase
UniProt Gene Name
DHCR24
UniProt Synonym Gene Names
KIAA0018
UniProt Entry Name
DHC24_HUMAN

Similar Products

Product Notes

The DHCR24 dhcr24 (Catalog #AAA199767) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHCR24 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DHCR24 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DHCR24 dhcr24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLLPLSLIFD IYYYVRAWVV FKLSSAPRLH EQRVRDIQKQ VREWKEQGSK. It is sometimes possible for the material contained within the vial of "DHCR24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.