Rabbit DHDDS Polyclonal Antibody | anti-DHDDS antibody
DHDDS Antibody - C-terminal region
Gene Names
DHDDS; DS; CIT; CPT; HDS; RP59; hCIT; DEDSM
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DHDDS, Antibody; DHDDS Antibody - C-terminal region; anti-DHDDS antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARR
Sequence Length
333
Applicable Applications for anti-DHDDS antibody
WB (Western Blot)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHDDS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-DHDDS antibody
This is a rabbit polyclonal antibody against DHDDS. It was validated on Western Blot
Target Description: The protein encoded by this gene catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. Mutations in this gene are associated with retinitis pigmentosa type 59. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Target Description: The protein encoded by this gene catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. Mutations in this gene are associated with retinitis pigmentosa type 59. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-DHDDS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
dehydrodolichyl diphosphate synthase complex subunit DHDDS isoform 4
NCBI Official Synonym Full Names
dehydrodolichyl diphosphate synthase subunit
NCBI Official Symbol
DHDDS
NCBI Official Synonym Symbols
DS; CIT; CPT; HDS; RP59; hCIT; DEDSM
NCBI Protein Information
dehydrodolichyl diphosphate synthase complex subunit DHDDS
UniProt Protein Name
Dehydrodolichyl diphosphate synthase
UniProt Gene Name
DHDDS
UniProt Synonym Gene Names
HDS; Dedol-PP synthase; CIT; Cis-IPTase
UniProt Entry Name
DHDDS_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The DHDDS dhdds (Catalog #AAA199965) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHDDS Antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DHDDS can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DHDDS dhdds for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARDMYAEERK RQQLERDQAT VTEQLLREGL QASGDAQLRR TRLHKLSARR. It is sometimes possible for the material contained within the vial of "DHDDS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
