Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198082_WB11.jpg WB (Western Blot) (WB Suggested Anti-DHX30 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateDHX30 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit DHX30 Polyclonal Antibody | anti-DHX30 antibody

DHX30 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
DHX30; DDX30; RETCOR; NEDMIAL
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
DHX30, Antibody; DHX30 antibody - N-terminal region; anti-DHX30 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD
Sequence Length
361
Applicable Applications for anti-DHX30 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DHX30
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DHX30 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateDHX30 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA198082_WB11.jpg WB (Western Blot) (WB Suggested Anti-DHX30 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateDHX30 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

IHC (Immunohiostchemistry)

(Rabbit Anti-DHX30 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA198082_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-DHX30 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Rabbit Anti-DHX30 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA198082_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-DHX30 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, moderate signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-DHX30 antibody
This is a rabbit polyclonal antibody against DHX30. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX30 is a member of this family.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The encoded protein has 97% sequence identity with the mouse HELG protein. Alternative splicing of this gene generates 3 transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Synonym Full Names
DExH-box helicase 30
NCBI Official Symbol
DHX30
NCBI Official Synonym Symbols
DDX30; RETCOR; NEDMIAL
NCBI Protein Information
ATP-dependent RNA helicase DHX30; putative ATP-dependent RNA helicase DHX30
UniProt Protein Name
Putative ATP-dependent RNA helicase DHX30
UniProt Gene Name
DHX30
UniProt Synonym Gene Names
DDX30; KIAA0890
UniProt Entry Name
DHX30_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DHX30 dhx30 (Catalog #AAA198082) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHX30 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's DHX30 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the DHX30 dhx30 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AESGMAPGGP GEGDGSLVNA SRDLLKEFPQ PKNLLNSVIG RALGISHAKD. It is sometimes possible for the material contained within the vial of "DHX30, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.