WB (Western Blot)
(WB Suggested Anti-DHX37 AntibodyTitration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)
Rabbit anti-Human DHX37 Polyclonal Antibody | anti-DHX37 antibody
DHX37 antibody - N-terminal region
Gene Names
DHX37; Dhr1; DDX37
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DHX37, Antibody; DHX37 antibody - N-terminal region; Dhr1, DDX37, SRXY11, NEDBAVC; anti-DHX37 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG
Sequence Length
1157
Applicable Applications for anti-DHX37 antibody
WB (Western Blot)
Predicted Species Reactivity
Human, Mouse, Rat, Dog, Horse, Pig, Rabbit
Homology
Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 79%; Rabbit: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DHX37
Protein Size
1157 amino acids
Protein Interactions
RGS17; TRIP6; KRT31; UBC; WHSC1; ATXN1; POLR1C; NAT10; SIRT7; TERF2; PLXNA2; DDX56
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-DHX37 AntibodyTitration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)
WB (Western Blot)
(WB Suggested Anti-DHX37 AntibodyTitration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)
Related Product Information for anti-DHX37 antibody
Target Description: DHX37 is a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.
Product Categories/Family for anti-DHX37 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
129kDa
NCBI Official Full Name
probable ATP-dependent RNA helicase DHX37
NCBI Official Synonym Full Names
DEAH-box helicase 37
NCBI Official Symbol
DHX37
NCBI Official Synonym Symbols
Dhr1; DDX37
NCBI Protein Information
probable ATP-dependent RNA helicase DHX37
UniProt Protein Name
Probable ATP-dependent RNA helicase DHX37
UniProt Gene Name
DHX37
UniProt Synonym Gene Names
DDX37; KIAA1517
UniProt Entry Name
DHX37_HUMAN
Similar Products
Product Notes
The DHX37 dhx37 (Catalog #AAA198081) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHX37 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHX37 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DHX37 dhx37 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLTKKEKKVL QKILEQKEKK SQRAEMLQKL SEVQASEAEM RLFYTTSKLG. It is sometimes possible for the material contained within the vial of "DHX37, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.