Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200070_WB13.jpg WB (Western Blot) (WB Suggested Anti-DISP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

Rabbit DISP1 Polyclonal Antibody | anti-DISP1 antibody

DISP1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
DISP1; DISPA
Reactivity
Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DISP1, Antibody; DISP1 antibody - middle region; anti-DISP1 antibody
Ordering
Host
Rabbit
Reactivity
Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV
Sequence Length
1524
Applicable Applications for anti-DISP1 antibody
WB (Western Blot)
Homology
Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 100%; Rat: 86%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DISP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DISP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

product-image-AAA200070_WB13.jpg WB (Western Blot) (WB Suggested Anti-DISP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Small Intestine)

WB (Western Blot)

(Host: RabbitTarget Name: DISP1Sample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200070_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: DISP1Sample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-DISP1 antibody
This is a rabbit polyclonal antibody against DISP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DISP1 functions in hedgehog (Hh) signaling. Regulates the release and extracellular accumulation of cholesterol-modified hedgehog proteins and is hence required for effective production of the Hh signal.The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in a graded manner according to the effective concentration of the signal, and this response produces the pattern of cell types constituting the mature structure. A novel segment-polarity gene known as dispatched has been identified in Drosophila and its protein product is required for normal Hedgehog (Hh) signaling. This gene is one of two human homologs of Drosophila dispatched and, based on sequence identity to its mouse counterpart, the encoded protein may play an essential role in Hh patterning activities in the early embryo.
Product Categories/Family for anti-DISP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
171kDa
NCBI Official Full Name
protein dispatched homolog 1 isoform 1
NCBI Official Synonym Full Names
dispatched RND transporter family member 1
NCBI Official Symbol
DISP1
NCBI Official Synonym Symbols
DISPA
NCBI Protein Information
protein dispatched homolog 1
UniProt Protein Name
Protein dispatched homolog 1
UniProt Gene Name
DISP1
UniProt Synonym Gene Names
DISPA
UniProt Entry Name
DISP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DISP1 disp1 (Catalog #AAA200070) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DISP1 antibody - middle region reacts with Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DISP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DISP1 disp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FVLCDVWNYT KFDKPHAETS ETVSITLQHA ALSMFVTSFT TAAAFYANYV. It is sometimes possible for the material contained within the vial of "DISP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.