Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197889_WB13.jpg WB (Western Blot) (WB Suggested Anti-DMTF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)

Rabbit DMTF1 Polyclonal Antibody | anti-DMTF1 antibody

DMTF1 Antibody - middle region

Gene Names
DMTF1; DMP1; DMTF; MRUL; hDMP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DMTF1, Antibody; DMTF1 Antibody - middle region; anti-DMTF1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDL
Sequence Length
760
Applicable Applications for anti-DMTF1 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DMTF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DMTF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)

product-image-AAA197889_WB13.jpg WB (Western Blot) (WB Suggested Anti-DMTF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)

WB (Western Blot)

(Host: MouseTarget Name: DMTF1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA197889_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: DMTF1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-DMTF1 antibody
This is a rabbit polyclonal antibody against DMTF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
cyclin-D-binding Myb-like transcription factor 1 isoform a
NCBI Official Synonym Full Names
cyclin D binding myb like transcription factor 1
NCBI Official Symbol
DMTF1
NCBI Official Synonym Symbols
DMP1; DMTF; MRUL; hDMP1
NCBI Protein Information
cyclin-D-binding Myb-like transcription factor 1
UniProt Protein Name
Cyclin-D-binding Myb-like transcription factor 1
UniProt Gene Name
DMTF1
UniProt Synonym Gene Names
DMP1; hDMTF1; hDMP1
UniProt Entry Name
DMTF1_HUMAN

Similar Products

Product Notes

The DMTF1 dmtf1 (Catalog #AAA197889) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DMTF1 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DMTF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DMTF1 dmtf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TFPDEIHHPK MTVEPSFNDA HVSKFSDQNS TELMNSVMVR TEEEISDTDL. It is sometimes possible for the material contained within the vial of "DMTF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.