WB (Western Blot)
(WB Suggested Anti-DNAI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateDNAI2 is supported by BioGPS gene expression data to be expressed in PANC1)
Rabbit DNAI2 Polyclonal Antibody | anti-DNAI2 antibody
DNAI2 antibody - N-terminal region
Gene Names
DNAI2; DIC2; CILD9
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DNAI2, Antibody; DNAI2 antibody - N-terminal region; anti-DNAI2 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHC
Applicable Applications for anti-DNAI2 antibody
WB (Western Blot)
Protein Size (# AA)
605 amino acids
Blocking Peptide
For anti-DNAI2 (MBS3206467) antibody is
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DNAI2
Replacement Item
This antibody may replace item sc-32218 from Santa Cruz Biotechnology.
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-DNAI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateDNAI2 is supported by BioGPS gene expression data to be expressed in PANC1)
WB (Western Blot)
(WB Suggested Anti-DNAI2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateDNAI2 is supported by BioGPS gene expression data to be expressed in PANC1)
Related Product Information for anti-DNAI2 antibody
This is a rabbit polyclonal antibody against DNAI2. It was validated on Western Blot
Target Description: The protein encoded by this gene belongs to the dynein intermediate chain family, and is part of the dynein complex of respiratory cilia and sperm flagella. Mutations in this gene are associated with primary ciliary dyskinesia type 9. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Target Description: The protein encoded by this gene belongs to the dynein intermediate chain family, and is part of the dynein complex of respiratory cilia and sperm flagella. Mutations in this gene are associated with primary ciliary dyskinesia type 9. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Product Categories/Family for anti-DNAI2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
dynein intermediate chain 2, axonemal isoform 1
NCBI Official Synonym Full Names
dynein axonemal intermediate chain 2
NCBI Official Symbol
DNAI2
NCBI Official Synonym Symbols
DIC2; CILD9
NCBI Protein Information
dynein intermediate chain 2, axonemal
UniProt Protein Name
Dynein intermediate chain 2, axonemal
UniProt Gene Name
DNAI2
UniProt Entry Name
DNAI2_HUMAN
Similar Products
Product Notes
The DNAI2 dnai2 (Catalog #AAA199148) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNAI2 antibody - N-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DNAI2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DNAI2 dnai2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TRGVNHVEGG WPKDVNPLEL EQTIRFRKKV EKDENYVNAI MQLGSIMEHC. It is sometimes possible for the material contained within the vial of "DNAI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.