Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198413_WB13.jpg WB (Western Blot) (WB Suggested Anti-Dpf3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)

Rabbit Dpf3 Polyclonal Antibody | anti-DPF3 antibody

Dpf3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Dpf3; CERD4; BAF45C; C78788; cer-d4; 2810403B03Rik; 6530402L11Rik
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Dpf3, Antibody; Dpf3 antibody - N-terminal region; anti-DPF3 antibody
Ordering
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCY
Sequence Length
356
Applicable Applications for anti-DPF3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Dpf3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)

product-image-AAA198413_WB13.jpg WB (Western Blot) (WB Suggested Anti-Dpf3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)

IHC (Immunohistochemistry)

(Rabbit Anti-Dpf3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Nuclear (not in cardiomyocytes but in fibrocytes in endomysiumPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA198413_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-Dpf3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Nuclear (not in cardiomyocytes but in fibrocytes in endomysiumPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-DPF3 antibody
This is a rabbit polyclonal antibody against Dpf3. It was validated on Western Blot

Target Description: Dpf3 is a muscle-specific component of the BAF complex, a multiprotein complex involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Dpf3 specifically binds acetylated lysines on histone 3 and 4 (H3K14ac, H3K9ac, H4K5ac, H4K8ac, H4K12ac, H4K16ac). In the complex, it acts as a tissue-specific anchor between histone acetylations and methylations and chromatin remodeling. It thereby probably plays an essential role in heart and skeletal muscle development. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
zinc finger protein DPF3 isoform 3
NCBI Official Synonym Full Names
D4, zinc and double PHD fingers, family 3
NCBI Official Symbol
Dpf3
NCBI Official Synonym Symbols
CERD4; BAF45C; C78788; cer-d4; 2810403B03Rik; 6530402L11Rik
NCBI Protein Information
zinc finger protein DPF3
UniProt Protein Name
Zinc finger protein DPF3
UniProt Gene Name
Dpf3
UniProt Synonym Gene Names
Baf45c; Cerd4; BAF45C
UniProt Entry Name
DPF3_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DPF3 dpf3 (Catalog #AAA198413) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Dpf3 antibody - N-terminal region reacts with Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Dpf3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the DPF3 dpf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IHNPLKALGD QFYKEAIEHC RSYNSRLCAE RSVRLPFLDS QTGVAQNNCY. It is sometimes possible for the material contained within the vial of "Dpf3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.