Rabbit DPH5 Polyclonal Antibody | anti-DPH5 antibody
DPH5 Antibody - middle region
Gene Names
DPH5; AD-018; CGI-30; NPD015; HSPC143
Reactivity
Tested: Human; Predicted: Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DPH5, Antibody; DPH5 Antibody - middle region; anti-DPH5 antibody
Host
Rabbit
Reactivity
Tested: Human; Predicted: Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Applicable Applications for anti-DPH5 antibody
WB (Western Blot)
Protein Size (# AA)
234 amino acids
Official Gene Full Name
diphthamide biosynthesis 5
Peptide Sequence
Synthetic peptide located within the following region: ESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQ
Blocking Peptide
For anti-DPH5 (MBS3222742) antibody is Catalog # MBS3247409
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human DPH5
Protein Name
diphthine methyl ester synthase
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-DPH5 antibody
Description of Target: This gene encodes a component of the diphthamide synthesis pathway. Diphthamide is a post-translationally modified histidine residue found only on translation elongation factor 2. It is conserved from archaebacteria to humans, and is targeted by diphtheria toxin and Pseudomonas exotoxin A to halt cellular protein synthesis. The yeast and Chinese hamster homologs of this protein catalyze the trimethylation of the histidine residue on elongation factor 2, resulting in a diphthine moiety that is subsequently amidated to yield diphthamide. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-DPH5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
diphthine methyl ester synthase isoform a
NCBI Official Synonym Full Names
diphthamide biosynthesis 5
NCBI Official Symbol
DPH5
NCBI Official Synonym Symbols
AD-018; CGI-30; NPD015; HSPC143
NCBI Protein Information
diphthine methyl ester synthase
UniProt Protein Name
Diphthine synthase
UniProt Gene Name
DPH5
UniProt Entry Name
DPH5_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The DPH5 dph5 (Catalog #AAA201616) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPH5 Antibody - middle region reacts with Tested: Human; Predicted: Human and may cross-react with other species as described in the data sheet. AAA Biotech's DPH5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DPH5 dph5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DPH5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
