Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201263_WB13.jpg WB (Western Blot) (WB Suggested Anti-DPP9 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit DPP9 Polyclonal Antibody | anti-DPP9 antibody

DPP9 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
DPP9; DP9; DPLP9; DPRP2; DPP IX; DPRP-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
DPP9, Antibody; DPP9 antibody - N-terminal region; anti-DPP9 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FVQKTDESGPHSHRLYYLGMPYGSRENSLLYSEIPKKVRKEALLLLSWKQ
Sequence Length
850
Applicable Applications for anti-DPP9 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DPP9 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

product-image-AAA201263_WB13.jpg WB (Western Blot) (WB Suggested Anti-DPP9 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

IHC (Immunohistochemistry)

(Rabbit Anti-DPP9 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201263_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-DPP9 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-DPP9 antibody
This is a rabbit polyclonal antibody against DPP9. It was validated on Western Blot

Target Description: This gene encodes a protein that is a member of the S9B family in clan SC of the serine proteases. The protein has been shown to have post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Although the activity of this protein is similar to that of dipeptidyl peptidase 4 (DPP4), it does not appear to be membrane bound. In general, dipeptidyl peptidases appear to be involved in the regulation of the activity of their substrates and have been linked to a variety of diseases including type 2 diabetes, obesity and cancer. Several transcript variants of this gene have been described but not fully characterized.
Product Categories/Family for anti-DPP9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
dipeptidyl peptidase 9 isoform 1
NCBI Official Synonym Full Names
dipeptidyl peptidase 9
NCBI Official Symbol
DPP9
NCBI Official Synonym Symbols
DP9; DPLP9; DPRP2; DPP IX; DPRP-2
NCBI Protein Information
dipeptidyl peptidase 9
UniProt Protein Name
Dipeptidyl peptidase 9
UniProt Gene Name
DPP9
UniProt Synonym Gene Names
DPRP2; DP9; DPRP-2; DPP IX; DPLP9
UniProt Entry Name
DPP9_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DPP9 dpp9 (Catalog #AAA201263) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPP9 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DPP9 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the DPP9 dpp9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FVQKTDESGP HSHRLYYLGM PYGSRENSLL YSEIPKKVRK EALLLLSWKQ. It is sometimes possible for the material contained within the vial of "DPP9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.