Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282256_IF13.jpg IF (Immunofluorescence) (Confocal immunofluorescence analysis of U-2 OS cells using DRP1 Polyclonal Antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Rat DRP1 Polyclonal Antibody | anti-DRP1 antibody

DRP1 Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Human, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
DRP1, Antibody; DRP1 Rabbit pAb; DNM1L; DLP1; DRP1; DVLP; DYMPLE; EMPF; EMPF1; HDYNIV; dynamin 1 like; anti-DRP1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL
Applicable Applications for anti-DRP1 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
Rat brain
Immunogen
Recombinant protein of human DRP1.
Cellular Location
Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Golgi apparatus, Membrane, Mitochondrion outer membrane, Peripheral membrane protein, Peroxisome, clathrin-coated pit, cytosol, secretory vesicle, synaptic vesicle membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Confocal immunofluorescence analysis of U-2 OS cells using DRP1 Polyclonal Antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

product-image-AAA282256_IF13.jpg IF (Immunofluorescence) (Confocal immunofluorescence analysis of U-2 OS cells using DRP1 Polyclonal Antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of Rat brain, using DRP1 antibody at 1:400 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA282256_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of Rat brain, using DRP1 antibody at 1:400 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-DRP1 antibody
This gene encodes a member of the dynamin superfamily of GTPases. The encoded protein mediates mitochondrial and peroxisomal division, and is involved in developmentally regulated apoptosis and programmed necrosis. Dysfunction of this gene is implicated in several neurological disorders, including Alzheimer's disease. Mutations in this gene are associated with the autosomal dominant disorder, encephalopathy, lethal, due to defective mitochondrial and peroxisomal fission (EMPF). Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,051 Da
NCBI Official Full Name
cyclin-dependent kinase 2-interacting protein
NCBI Official Synonym Full Names
cyclin-dependent kinase 2 interacting protein
NCBI Official Symbol
CINP
NCBI Protein Information
cyclin-dependent kinase 2-interacting protein; CDK2-interacting protein
UniProt Protein Name
Cyclin-dependent kinase 2-interacting protein
UniProt Gene Name
CINP
UniProt Synonym Gene Names
CDK2-interacting protein
UniProt Entry Name
CINP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DRP1 cinp (Catalog #AAA282256) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DRP1 Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DRP1 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the DRP1 cinp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEAKTLGTVT PRKPVLSVSA RKIKDNAADW HNLILKWETL NDAGFTTANN IANLKISLLN KDKIELDSSS PASKENEEKV CLEYNEELEK LCEELQATLD GLTKIQVKME KLSSTTKGIC ELENYHYGEE SKRPPLFHTW PTTHFYEVSH KLLEMYRKEL LLKRTVAKEL AHTGDPDLTL SYLSMWLHQP YVESDSRLHL ESMLLETGHR AL. It is sometimes possible for the material contained within the vial of "DRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.