Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199519_WB13.jpg WB (Western Blot) (WB Suggested Anti-DSCAM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Rabbit DSCAM Polyclonal Antibody | anti-DSCAM antibody

DSCAM antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
DSCAM; CHD2; CHD2-42; CHD2-52
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
DSCAM, Antibody; DSCAM antibody - middle region; anti-DSCAM antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV
Sequence Length
2012
Applicable Applications for anti-DSCAM antibody
IP (Immunoprecipitation), WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DSCAM
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DSCAM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

product-image-AAA199519_WB13.jpg WB (Western Blot) (WB Suggested Anti-DSCAM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Sample Type: MouseAmount and Sample Type :10 cm sq plate myc-DSCAM transfected mouse neuro2a cellsPrimary Antibody :DSCAMPrimary Antibody Dilution :1:1000Secondary Antibody :Anti-Rabbit HRPSecondary Antibody Dilution :1:5000Gene Name :DSCAMSubmitted by :Amir Gamliel, UCSD)

product-image-AAA199519_WB15.jpg WB (Western Blot) (Sample Type: MouseAmount and Sample Type :10 cm sq plate myc-DSCAM transfected mouse neuro2a cellsPrimary Antibody :DSCAMPrimary Antibody Dilution :1:1000Secondary Antibody :Anti-Rabbit HRPSecondary Antibody Dilution :1:5000Gene Name :DSCAMSubmitted by :Amir Gamliel, UCSD)
Related Product Information for anti-DSCAM antibody
This is a rabbit polyclonal antibody against DSCAM. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DSCAM is a cell adhesion molecule that can mediate cation-independent homophilic binding activity. DSCAM could be involved in nervous system development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
220kDa
NCBI Official Full Name
Down syndrome cell adhesion molecule isoform CHD2-42
NCBI Official Synonym Full Names
DS cell adhesion molecule
NCBI Official Symbol
DSCAM
NCBI Official Synonym Symbols
CHD2; CHD2-42; CHD2-52
NCBI Protein Information
Down syndrome cell adhesion molecule
UniProt Protein Name
Down syndrome cell adhesion molecule
UniProt Gene Name
DSCAM
UniProt Entry Name
DSCAM_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DSCAM dscam (Catalog #AAA199519) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DSCAM antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DSCAM can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the DSCAM dscam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRVCNSAGCA EKQANFATLN YDGSTIPPLI KSVVQNEEGL TTNEGLKMLV. It is sometimes possible for the material contained within the vial of "DSCAM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.