Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283291_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Dental pulp stem cell using DSPP Rabbit pAb (AAA283291) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Human DSPP Polyclonal Antibody | anti-DSPP antibody

DSPP Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
DSPP, Antibody; DSPP Rabbit pAb; DPP; DSP; DGI1; DMP3; DFNA39; DSPP; anti-DSPP antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
IPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNAGATNRSNTNGNTDKNTQNGDVGDAGHNEDVAVVQEDGPQVAGSNNSTDNEDEIIENSCRNEGNTSEITPQINSKRNGTKEAEVT
Applicable Applications for anti-DSPP antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant Protein corresponding to a sequence within amino acids 16-230 of human DSPP(NP_055023.2-).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of Dental pulp stem cell using DSPP Rabbit pAb (AAA283291) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283291_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Dental pulp stem cell using DSPP Rabbit pAb (AAA283291) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and 293F cells transfected with DSPP using DSPP Rabbit pAb (AAA283291) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 40.5 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA283291_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and 293F cells transfected with DSPP using DSPP Rabbit pAb (AAA283291) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 40.5 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-DSPP antibody
This gene encodes a member of the small integrin-binding ligand N-linked glycoprotein (SIBLING) family of proteins. The encoded preproprotein is secreted by odontoblasts and proteolytically processed to generate two principal proteins of the dentin extracellular matrix of the tooth, dentin sialoprotein and dentin phosphoprotein. These two protein products may play distinct but related roles in dentin mineralization. Mutations in this gene are associated with dentinogenesis imperfecta and dentin dysplasia. This gene is present in a gene cluster on chromosome 4. Allelic differences due to repeat polymorphisms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 131kDa
Observed MW: 97kDa, 131kDa
UniProt Protein Name
Dentin sialophosphoprotein
UniProt Gene Name
DSPP
UniProt Synonym Gene Names
DPP; DSP
UniProt Entry Name
DSPP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DSPP dspp (Catalog #AAA283291) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DSPP Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DSPP can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the DSPP dspp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IPVPQSKPLE RHVEKSMNLH LLARSNVSVQ DELNASGTIK ESGVLVHEGD RGRQENTQDG HKGEGNGSKW AEVGGKSFST YSTLANEEGN IEGWNGDTGK AETYGHDGIH GKEENITANG IQGQVSIIDN AGATNRSNTN GNTDKNTQNG DVGDAGHNED VAVVQEDGPQ VAGSNNSTDN EDEIIENSCR NEGNTSEITP QINSKRNGTK EAEVT. It is sometimes possible for the material contained within the vial of "DSPP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.