Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201277_WB10.jpg WB (Western Blot) (WB Suggested Anti-DYRK2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit DYRK2 Polyclonal Antibody | anti-DYRK2 antibody

DYRK2 antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DYRK2, Antibody; DYRK2 antibody - C-terminal region; anti-DYRK2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITES
Sequence Length
528
Applicable Applications for anti-DYRK2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DYRK2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

product-image-AAA201277_WB10.jpg WB (Western Blot) (WB Suggested Anti-DYRK2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: DYRK2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA201277_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: DYRK2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: DYRK2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA201277_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: DYRK2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-DYRK2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201277_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-DYRK2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-DYRK2 antibody
This is a rabbit polyclonal antibody against DYRK2. It was validated on Western Blot

Target Description: DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine residues. DYRK2 has demonstrated tyrosine autophosphorylation and catalyzed phosphorylation of histones H3 and H2B in vitro.
Product Categories/Family for anti-DYRK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
dual specificity tyrosine-phosphorylation-regulated kinase 2 isoform 1
NCBI Official Synonym Full Names
dual specificity tyrosine phosphorylation regulated kinase 2
NCBI Official Symbol
DYRK2
NCBI Protein Information
dual specificity tyrosine-phosphorylation-regulated kinase 2
UniProt Protein Name
Dual specificity tyrosine-phosphorylation-regulated kinase 2
UniProt Gene Name
DYRK2
UniProt Entry Name
DYRK2_HUMAN

Similar Products

Product Notes

The DYRK2 dyrk2 (Catalog #AAA201277) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DYRK2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DYRK2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DYRK2 dyrk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFLDFLKQCL EWDPAVRMTP GQALRHPWLR RRLPKPPTGE KTSVKRITES. It is sometimes possible for the material contained within the vial of "DYRK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.