Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197112_WB13.jpg WB (Western Blot) (WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Rabbit anti-Human, Mouse DYRK3 Polyclonal Antibody | anti-DYRK3 antibody

DYRK3 antibody - N-terminal region

Gene Names
DYRK3; RED; REDK; DYRK5; hYAK3-2
Reactivity
Human, Mouse
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
DYRK3, Antibody; DYRK3 antibody - N-terminal region; anti-DYRK3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
Sequence Length
588
Applicable Applications for anti-DYRK3 antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Human: 100%; Mouse: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DYRK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

product-image-AAA197112_WB13.jpg WB (Western Blot) (WB Suggested Anti-DYRK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

IF (Immunofluorescence)

(Sample Type :HeLa cells Primary Antibody Dilution :1:50 Secondary Antibody :Gaot anti-rabbit-Alexa Fluor Secondary Antibody Dilution :1:250 Color/Signal Descriptions :Green: DYRK3Red: PABP1Blue: DAPIGene Name :DYRK3Submitted by :Frank Wippich, Institute of Molecular Life Sciences, University of Zurich)

product-image-AAA197112_IF15.jpg IF (Immunofluorescence) (Sample Type :HeLa cells Primary Antibody Dilution :1:50 Secondary Antibody :Gaot anti-rabbit-Alexa Fluor Secondary Antibody Dilution :1:250 Color/Signal Descriptions :Green: DYRK3Red: PABP1Blue: DAPIGene Name :DYRK3Submitted by :Frank Wippich, Institute of Molecular Life Sciences, University of Zurich)
Related Product Information for anti-DYRK3 antibody
This is a rabbit polyclonal antibody against DYRK3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
dual specificity tyrosine-phosphorylation-regulated kinase 3 isoform a
NCBI Official Synonym Full Names
dual specificity tyrosine phosphorylation regulated kinase 3
NCBI Official Symbol
DYRK3
NCBI Official Synonym Symbols
RED; REDK; DYRK5; hYAK3-2
NCBI Protein Information
dual specificity tyrosine-phosphorylation-regulated kinase 3
UniProt Protein Name
Dual specificity tyrosine-phosphorylation-regulated kinase 3
UniProt Gene Name
DYRK3
UniProt Synonym Gene Names
REDK
UniProt Entry Name
DYRK3_HUMAN

Similar Products

Product Notes

The DYRK3 dyrk3 (Catalog #AAA197112) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DYRK3 antibody - N-terminal region reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DYRK3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the DYRK3 dyrk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GDHTQHFLDG GEMKVEQLFQ EFGNRKSNTI QSDGISDSEK CSPTVSQGKS. It is sometimes possible for the material contained within the vial of "DYRK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.