Rabbit E2F5 Polyclonal Antibody | anti-E2F5 antibody
E2F5 antibody - N-terminal region
Gene Names
E2F5; E2F-5
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
E2F5, Antibody; E2F5 antibody - N-terminal region; anti-E2F5 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN
Sequence Length
346
Applicable Applications for anti-E2F5 antibody
WB (Western Blot)
Homology
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 84%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human E2F5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-E2F5 antibody
This is a rabbit polyclonal antibody against E2F5. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: E2F5 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of human tissues. It is more homologous to E2F4, a family member, than to other members. Both this protein and E2F4 interact with tumor suppressor proteins p130 and p107, but not with pRB.
Target Description: E2F5 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of human tissues. It is more homologous to E2F4, a family member, than to other members. Both this protein and E2F4 interact with tumor suppressor proteins p130 and p107, but not with pRB.
Product Categories/Family for anti-E2F5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
transcription factor E2F5 isoform 1
NCBI Official Synonym Full Names
E2F transcription factor 5
NCBI Official Symbol
E2F5
NCBI Official Synonym Symbols
E2F-5
NCBI Protein Information
transcription factor E2F5
UniProt Protein Name
Transcription factor E2F5
UniProt Gene Name
E2F5
UniProt Synonym Gene Names
E2F-5
UniProt Entry Name
E2F5_HUMAN
Similar Products
Product Notes
The E2F5 e2f5 (Catalog #AAA201788) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The E2F5 antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's E2F5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the E2F5 e2f5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAEIEDLELK ERELDQQKLL LQQSIKNVMD DSINNRFSYV THEDICNCFN. It is sometimes possible for the material contained within the vial of "E2F5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
