Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282378_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of HT-29 cells, using Edf1 antibody (AAA282378) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s.)

Rabbit anti-Human, Mouse Edf1 Polyclonal Antibody | anti-Edf1 antibody

[KO Validated] Edf1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
Edf1; AA409425; 0610008L11Rik
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
Edf1, Antibody; [KO Validated] Edf1 Rabbit pAb; MBF1; 0610008L11Rik; anti-Edf1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPKAK
Applicable Applications for anti-Edf1 antibody
WB (Western Blot)
Positive Samples
HT-29, NIH/3T3
Cellular Location
cytoplasm, cytosol, nucleolus, nucleoplasm, nucleus
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of mouse Edf1 (NP_067494.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

WB (Western Blot)

(Western blot analysis of extracts of HT-29 cells, using Edf1 antibody (AAA282378) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s.)

product-image-AAA282378_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of HT-29 cells, using Edf1 antibody (AAA282378) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts from normal (control) and Edf1 knockout (KO) NIH/3T3 cells, using Edf1 antibody (AAA282378) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s.)

product-image-AAA282378_WB15.jpg WB (Western Blot) (Western blot analysis of extracts from normal (control) and Edf1 knockout (KO) NIH/3T3 cells, using Edf1 antibody (AAA282378) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s.)
Related Product Information for anti-Edf1 antibody
Predicted to enable TFIID-class transcription factor complex binding activity and transcription coactivator activity. Predicted to be involved in positive regulation of DNA binding activity. Predicted to act upstream of or within cell differentiation. Predicted to be located in cytosol; nucleolus; and nucleoplasm. Predicted to be active in nucleus. Is expressed in several structures, including central nervous system; genitourinary system; heart; liver; and retina. Orthologous to human EDF1 (endothelial differentiation related factor 1).
Product Categories/Family for anti-Edf1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,369 Da
NCBI Official Full Name
endothelial differentiation-related factor 1
NCBI Official Synonym Full Names
endothelial differentiation-related factor 1
NCBI Official Symbol
Edf1
NCBI Official Synonym Symbols
AA409425; 0610008L11Rik
NCBI Protein Information
endothelial differentiation-related factor 1; MBF1; EDF-1; hypothetical protein 1-9; multiprotein-bridging factor 1
UniProt Protein Name
Endothelial differentiation-related factor 1
UniProt Gene Name
Edf1
UniProt Synonym Gene Names
EDF-1; MBF1
UniProt Entry Name
EDF1_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Edf1 edf1 (Catalog #AAA282378) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Edf1 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Edf1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the Edf1 edf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAESDWDTVT VLRKKGPTAA QAKSKQAILA AQRRGEDVET SKKWAAGQNK QHSITKNTAK LDRETEELHH DRVTLEVGKV IQRGRQSKGL TQKDLATKIN EKPQVIADYE SGRAIPNNQV LGKIERAIGL KLRGKDIGKP IEKGPKAK. It is sometimes possible for the material contained within the vial of "Edf1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.