Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201370_WB13.jpg WB (Western Blot) (WB Suggested Anti-EIF2B3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Rabbit EIF2B3 Polyclonal Antibody | anti-EIF2B3 antibody

EIF2B3 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
EIF2B3; EIF-2B; EIF2Bgamma
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EIF2B3, Antibody; EIF2B3 Antibody - middle region; anti-EIF2B3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSF
Sequence Length
452
Applicable Applications for anti-EIF2B3 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%; Yeast: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human EIF2B3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EIF2B3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

product-image-AAA201370_WB13.jpg WB (Western Blot) (WB Suggested Anti-EIF2B3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

WB (Western Blot)

(Host: RabbitTarget Name: EIF2B3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA201370_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: EIF2B3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-EIF2B3 antibody
This is a rabbit polyclonal antibody against EIF2B3. It was validated on Western Blot

Target Description: The protein encoded by this gene is one of the subunits of initiation factor eIF2B, which catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. It has also been found to function as a cofactor of hepatitis C virus internal ribosome entry site-mediated translation. Mutations in this gene have been associated with leukodystrophy with vanishing white matter. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-EIF2B3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
translation initiation factor eIF-2B subunit gamma isoform 1
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2B subunit gamma
NCBI Official Symbol
EIF2B3
NCBI Official Synonym Symbols
EIF-2B; EIF2Bgamma
NCBI Protein Information
translation initiation factor eIF-2B subunit gamma
UniProt Protein Name
Translation initiation factor eIF-2B subunit gamma
UniProt Gene Name
EIF2B3
UniProt Entry Name
EI2BG_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EIF2B3 eif2b3 (Catalog #AAA201370) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF2B3 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's EIF2B3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the EIF2B3 eif2b3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENGSITSIRS ELIPYLVRKQ FSSASSQQGQ EEKEEDLKKK ELKSLDIYSF. It is sometimes possible for the material contained within the vial of "EIF2B3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.