WB (Western Blot)
(WB Suggested Anti-Elf3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Trachea)
Rabbit anti-Mouse, Rat Elf3 Polyclonal Antibody | anti-ELF3 antibody
Elf3 antibody - N-terminal region
Gene Names
Elf3; ESX; jen; ESE-1
Reactivity
Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
Elf3, Antibody; Elf3 antibody - N-terminal region; anti-ELF3 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL
Sequence Length
371
Applicable Applications for anti-ELF3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Mouse: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Elf3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Elf3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Trachea)
WB (Western Blot)
(WB Suggested Anti-Elf3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Trachea)
IHC (Immunohistochemistry)
(Mouse Stomach)
IHC (Immunohistochemistry)
(Mouse Stomach)
Related Product Information for anti-ELF3 antibody
This is a rabbit polyclonal antibody against Elf3. It was validated on Western Blot and immunohistochemistry
Target Description: Elf3 is a transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter (By similarity). It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector of the ERBB2 signaling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.
Target Description: Elf3 is a transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter (By similarity). It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector of the ERBB2 signaling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.
Product Categories/Family for anti-ELF3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
ETS-related transcription factor Elf-3 isoform 2
NCBI Official Synonym Full Names
E74-like factor 3
NCBI Official Symbol
Elf3
NCBI Official Synonym Symbols
ESX; jen; ESE-1
NCBI Protein Information
ETS-related transcription factor Elf-3
UniProt Protein Name
ETS-related transcription factor Elf-3
UniProt Gene Name
Elf3
UniProt Synonym Gene Names
ESE-1
Similar Products
Product Notes
The ELF3 elf3 (Catalog #AAA198138) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Elf3 antibody - N-terminal region reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Elf3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ELF3 elf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAATCEISNV FSNYFNAMYS SEDPTLAPAP PTTFGTEDLV LTLNNQQMTL. It is sometimes possible for the material contained within the vial of "Elf3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.