Rabbit ELOA Polyclonal Antibody | anti-ELOA antibody
ELOA Antibody - C-terminal region
Gene Names
ELOA; SIII; TCEB3; TCEB3A; SIII p110
Reactivity
Dog, Guinea Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
ELOA, Antibody; ELOA Antibody - C-terminal region; anti-ELOA antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTIKAFKNRFSRR
Sequence Length
772
Applicable Applications for anti-ELOA antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 100%; Guinea Pig: 91%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TCEB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-ELOA antibody
This is a rabbit polyclonal antibody against TCEB3. It was validated on Western Blot and immunohistochemistry
Target Description: This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.
Target Description: This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.
Product Categories/Family for anti-ELOA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
elongin-A
NCBI Official Synonym Full Names
elongin A
NCBI Official Symbol
ELOA
NCBI Official Synonym Symbols
SIII; TCEB3; TCEB3A; SIII p110
NCBI Protein Information
elongin-A
UniProt Protein Name
Transcription elongation factor B polypeptide 3
UniProt Gene Name
TCEB3
UniProt Synonym Gene Names
EloA
UniProt Entry Name
ELOA1_HUMAN
Similar Products
Product Notes
The ELOA tceb3 (Catalog #AAA201744) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELOA Antibody - C-terminal region reacts with Dog, Guinea Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELOA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ELOA tceb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AYDGPSTSSA HLAPVVSSTV SYDPRKPTVK KIAPMMAKTI KAFKNRFSRR. It is sometimes possible for the material contained within the vial of "ELOA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
