IHC (Immunohistochemisry)
(Anti- EME1 Picoband antibody, AAA46354,IHC(P)IHC(P): Human Lung Cancer Tissue)
anti-Human, Rat EME1 Polyclonal Antibody | anti-EME1 antibody
Anti-EME1 Antibody
Gene Names
EME1; MMS4L; SLX2A
Reactivity
Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
EME1, Antibody; Anti-EME1 Antibody; Crossover junction endonuclease EME1; 6820428D13; EC 3.1.22.-; EME1; Eme1 essential meiotic endonuclease 1 homolog 1 (S. pombe); EME1, S. pombe, homolog of, 1; EME1_HUMAN; essential meiotic endonuclease 1 homolog 1 (S pombe); Essential Meiotic Endonuclease 1 Homolog 1; essential meiotic endonuclease 1 homolog 2; Essential meiotic endonuclease 1, S. pombe, homolog of, 1; FLJ31364; hMMS4; homolog of yeast EME1 endonuclease; MGC106543; MMS4; MMS4 homolog; MMS4L; essential meiotic structure-specific endonuclease 1; anti-EME1 antibody
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
583
Applicable Applications for anti-EME1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520-561aa DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ), different from the related mouse sequence by five amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
IHC (Immunohistochemisry)
(Anti- EME1 Picoband antibody, AAA46354,IHC(P)IHC(P): Human Lung Cancer Tissue)
IHC (Immunohistochemisry)
(Anti- EME1 Picoband antibody, AAA46354,IHC(P)IHC(P): Human Lung Cancer Tissue)
IHC (Immunohiostchemistry)
(Anti- EME1 Picoband antibody, AAA46354,IHC(P)IHC(P): Rat Intestine Tissue)
IHC (Immunohiostchemistry)
(Anti- EME1 Picoband antibody, AAA46354,IHC(P)IHC(P): Rat Intestine Tissue)
WB (Western Blot)
(Anti- EME1 Picoband antibody, AAA46354, Western blottingAll lanes: Anti EME1 (AAA46354) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: JURKAT Whole Cell Lysate at 40ugLane 3: HUT Whole Cell Lysate at 40ugPredicted bind size: 62KDObserved bind size: 62KD)
WB (Western Blot)
(Anti- EME1 Picoband antibody, AAA46354, Western blottingAll lanes: Anti EME1 (AAA46354) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: JURKAT Whole Cell Lysate at 40ugLane 3: HUT Whole Cell Lysate at 40ugPredicted bind size: 62KDObserved bind size: 62KD)
Related Product Information for anti-EME1 antibody
Description: Rabbit IgG polyclonal antibody for Crossover junction endonuclease EME1(EME1) detection. Tested with WB, IHC-P in Human;Rat.
Background: Crossover junction endonuclease EME1 is an enzyme that in humans is encoded by the EME1 gene. It is mapped to 17q21.33. This gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3'-flap structures and aberrant replication fork structures. Also, this protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants.
Background: Crossover junction endonuclease EME1 is an enzyme that in humans is encoded by the EME1 gene. It is mapped to 17q21.33. This gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3'-flap structures and aberrant replication fork structures. Also, this protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants.
References
1. "Entrez Gene: EME1 essential meiotic endonuclease 1 homolog 1 (S. pombe)". 2. Abraham, J., Lemmers, B., Hande, M. P., Moynahan, M. E., Chahwan, C., Ciccia, A., Essers, J., Hanada, K., Chahwan, R., Khaw, A. K., McPherson, P., Shehabeldin, A., Laister, R., Arrowsmith, C., Kanaar, R., West, S. C., Jasin, M., Hakem, R. Eme1 is involved in DNA damage processing and maintenance of genomic stability in mammalian cells. EMBO J. 22: 6137-6147, 2003. 3. Ciccia A, Constantinou A, West SC (Jun 2003). "Identification and characterization of the human mus81-eme1 endonuclease". J Biol Chem 278 (27): 25172-8.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
64,779 Da
NCBI Official Full Name
crossover junction endonuclease EME1 isoform 1
NCBI Official Synonym Full Names
essential meiotic structure-specific endonuclease 1
NCBI Official Symbol
EME1
NCBI Official Synonym Symbols
MMS4L; SLX2A
NCBI Protein Information
crossover junction endonuclease EME1
UniProt Protein Name
Crossover junction endonuclease EME1
UniProt Gene Name
EME1
UniProt Synonym Gene Names
MMS4; hMMS4
UniProt Entry Name
EME1_HUMAN
Similar Products
Product Notes
The EME1 eme1 (Catalog #AAA46354) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-EME1 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EME1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the EME1 eme1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EME1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.