Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201328_WB13.jpg WB (Western Blot) (WB Suggested Anti-EPHA6 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Rabbit EPHA6 Polyclonal Antibody | anti-EPHA6 antibody

EPHA6 Antibody - N-terminal region

Gene Names
EPHA6; EHK2; EK12; EPA6; EHK-2; HEK12; PRO57066
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EPHA6, Antibody; EPHA6 Antibody - N-terminal region; anti-EPHA6 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTG
Sequence Length
1130
Applicable Applications for anti-EPHA6 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human EPHA6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EPHA6 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

product-image-AAA201328_WB13.jpg WB (Western Blot) (WB Suggested Anti-EPHA6 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

WB (Western Blot)

(Lanes:Lane 1: 35ug H4 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:EPHA6Submitted by:Erika Mathes Lisabeth, Sanford-Burnham Medical Research Institute)

product-image-AAA201328_WB15.jpg WB (Western Blot) (Lanes:Lane 1: 35ug H4 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:EPHA6Submitted by:Erika Mathes Lisabeth, Sanford-Burnham Medical Research Institute)
Related Product Information for anti-EPHA6 antibody
This is a rabbit polyclonal antibody against EPHA6. It was validated on Western Blot

Target Description: EPHA6 is a receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling.
Product Categories/Family for anti-EPHA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126kDa
NCBI Official Full Name
ephrin type-A receptor 6 isoform a
NCBI Official Synonym Full Names
EPH receptor A6
NCBI Official Symbol
EPHA6
NCBI Official Synonym Symbols
EHK2; EK12; EPA6; EHK-2; HEK12; PRO57066
NCBI Protein Information
ephrin type-A receptor 6
UniProt Protein Name
Ephrin type-A receptor 6
UniProt Gene Name
EPHA6
UniProt Synonym Gene Names
EHK2; HEK12; EHK-2; EK12
UniProt Entry Name
EPHA6_HUMAN

Similar Products

Product Notes

The EPHA6 epha6 (Catalog #AAA201328) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EPHA6 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EPHA6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the EPHA6 epha6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DTIPRVDSSS LVEVRGSCVK SAEERDTPKL YCGADGDWLV PLGRCICSTG. It is sometimes possible for the material contained within the vial of "EPHA6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.