Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA11665_WB.jpg WB (Western Blot) (Anti- ERV31 antibody, Western blotting)

Rabbit anti-Human ERV31 Polyclonal Antibody | anti-ERV31 antibody

Anti-ERV31 Antibody

Average rating 0.0
No ratings yet
Gene Names
ERV3-1; ERV3; ERVR; envR; ERV-R; HERVR; HERV-R
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
ERV31, Antibody; Anti-ERV31 Antibody; Endogenous retrovirus group 3 member 1 Env polyprotein; Endogenous retroviral sequence 3; Endogenous retrovirus group 3 member 1; ENR1_HUMAN; Envelope polyprotein; envR; ERV R; ERV-3 envelope protein; ERV-R envelope protein; ERV3 1 envelope protein; ERV3; ERV3 envelope protein; ERV3-1; ERVR; FLJ23884; HERV R; HERV-R envelope protein; HERV-R_7q21.2 provirus ancestral Env polyprotein; HERVR; SU; TM; Transmembrane protein; endogenous retrovirus group 3, member 1; anti-ERV31 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
604
Applicable Applications for anti-ERV31 antibody
WB (Western Blot)
Application Notes
WB: Concentration: 0.1-0.5ug/ml / Tested Species: Human
Tested Species: In-house tested species with positive results.
Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575-604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
The lab provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit (please intquire) in Western Blot (WB).
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Anti- ERV31 antibody, Western blotting)

product-image-AAA11665_WB.jpg WB (Western Blot) (Anti- ERV31 antibody, Western blotting)
Related Product Information for anti-ERV31 antibody
HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.
References
1. Kato, N., Shimotohno, K., Van Leeuwen, D., Cohen, M. Human proviral mRNAs down regulated in choriocarcinoma encode a zinc finger protein related to Kruppel. Molec. Cell. Biol. 10: 4401-4405, 1990.  2. Kim, H.-S., Crow, T. J., Hyun, B.-H. Assignment of the endogenous retrovirus HERV-R (ERV3) to human chromosome 7q11.2 by radiation hybrid mapping. Cytogenet. Cell Genet. 89: 10 only, 2000.  3. O'Connell C, O'Brien S, Nash WG, Cohen M (Dec 1984). "ERV3, a full-length human endogenous provirus: chromosomal localization and evolutionary relationships". Virology 138 (2): 225-35.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
endogenous retrovirus group 3 member 1 Env polyprotein
NCBI Official Synonym Full Names
endogenous retrovirus group 3 member 1
NCBI Official Symbol
ERV3-1
NCBI Official Synonym Symbols
ERV3; ERVR; envR; ERV-R; HERVR; HERV-R
NCBI Protein Information
endogenous retrovirus group 3 member 1 Env polyprotein
UniProt Protein Name
Endogenous retrovirus group 3 member 1 Env polyprotein
UniProt Gene Name
ERV3-1
UniProt Synonym Gene Names
ERV3; ERV3 envelope protein; ERV-R envelope protein; SU; TM
UniProt Entry Name
ENR1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ERV31 erv3-1 (Catalog #AAA11665) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ERV31 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ERV31 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). WB: Concentration: 0.1-0.5ug/ml / Tested Species: Human Tested Species: In-house tested species with positive results. Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the ERV31 erv3-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ERV31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.