Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23449_WB6.jpg WB (Western Blot) (WB Suggested Anti-ESR2 antibody Titration: 1 ug/mLSample Type: Human liver)

Rabbit anti-Human, Rat ESR2 Polyclonal Antibody | anti-ESR2 antibody

ESR2 antibody - N-terminal region

Gene Names
ESR2; Erb; ESRB; ODG8; ESTRB; NR3A2; ER-BETA; ESR-BETA
Reactivity
Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ESR2, Antibody; ESR2 antibody - N-terminal region; anti-ESR2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPG
Sequence Length
530
Applicable Applications for anti-ESR2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ESR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ESR2 antibody Titration: 1 ug/mLSample Type: Human liver)

product-image-AAA23449_WB6.jpg WB (Western Blot) (WB Suggested Anti-ESR2 antibody Titration: 1 ug/mLSample Type: Human liver)

WB (Western Blot)

(WB Suggested Anti-ESR2 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA23449_WB5.jpg WB (Western Blot) (WB Suggested Anti-ESR2 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(WB Suggested Anti-ESR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)

product-image-AAA23449_WB4.jpg WB (Western Blot) (WB Suggested Anti-ESR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: ESR2Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA23449_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: ESR2Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: ESR2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23449_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: ESR2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rat Brain)

product-image-AAA23449_IHC.jpg IHC (Immunohistochemistry) (Rat Brain)
Related Product Information for anti-ESR2 antibody
This is a rabbit polyclonal antibody against ESR2. It was validated on Western Blot

Target Description: ESR2 is a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. It contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
estrogen receptor beta isoform 2
NCBI Official Synonym Full Names
estrogen receptor 2
NCBI Official Symbol
ESR2
NCBI Official Synonym Symbols
Erb; ESRB; ODG8; ESTRB; NR3A2; ER-BETA; ESR-BETA
NCBI Protein Information
estrogen receptor beta
UniProt Protein Name
Estrogen receptor beta
UniProt Gene Name
ESR2
UniProt Synonym Gene Names
ESTRB; NR3A2; ER-beta
UniProt Entry Name
ESR2_HUMAN

Similar Products

Product Notes

The ESR2 esr2 (Catalog #AAA23449) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESR2 antibody - N-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ESR2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ESR2 esr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SYVDSHHEYP AMTFYSPAVM NYSIPSNVTN LEGGPGRQTT SPNVLWPTPG. It is sometimes possible for the material contained within the vial of "ESR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.