Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281675_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2OS cells using Estrogen Receptor alpha (ESRα) antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit ESRalpha Polyclonal Antibody | anti-ESRalpha antibody

ESRalpha Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
ESR1; ER; ESR; Era; ESRA; NR3A1
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
ESRalpha, Antibody; ESRalpha Rabbit pAb; ESR1; ER; ESR; ESRA; ESTRR; Era; NR3A1; ER alpha; anti-ESRalpha antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCND
Applicable Applications for anti-ESRalpha antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human Estrogen Receptor alpha (ESRalpha)(NP_000116.2).
Cellular Location
Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic side, Golgi apparatus, Nucleus, Peripheral membrane protein, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2OS cells using Estrogen Receptor alpha (ESRα) antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281675_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2OS cells using Estrogen Receptor alpha (ESRα) antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using Estrogen Receptor alpha (ESRα) antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281675_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using Estrogen Receptor alpha (ESRα) antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using Estrogen Receptor alpha (ESRα) antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281675_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using Estrogen Receptor alpha (ESRα) antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-ESRalpha antibody
Background: This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative promoter usage and alternative splicing result in dozens of transcript variants, but the full-length nature of many of these variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,216 Da
NCBI Official Full Name
estrogen receptor
NCBI Official Synonym Full Names
estrogen receptor 1
NCBI Official Symbol
ESR1
NCBI Official Synonym Symbols
ER; ESR; Era; ESRA; NR3A1
NCBI Protein Information
estrogen receptor; ER-alpha; estradiol receptor; estrogen nuclear receptor alpha; estrogen receptor alpha E1-E2-1-2; estrogen receptor alpha E1-N2-E2-1-2; estrogen receptor alpha delta 4 +49 isoform; nuclear receptor subfamily 3 group A member 1; estrogen
UniProt Protein Name
Estrogen receptor
UniProt Gene Name
ESR1
UniProt Synonym Gene Names
ESR; NR3A1; ER
UniProt Entry Name
ESR1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ESRalpha esr1 (Catalog #AAA281675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESRalpha Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ESRalpha can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the ESRalpha esr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTMTLHTKAS GMALLHQIQG NELEPLNRPQ LKIPLERPLG EVYLDSSKPA VYNYPEGAAY EFNAAAAANA QVYGQTGLPY GPGSEAAAFG SNGLGGFPPL NSVSPSPLML LHPPPQLSPF LQPHGQQVPY YLENEPSGYT VREAGPPAFY RPNSDNRRQG GRERLASTND KGSMAMESAK ETRYCAVCND. It is sometimes possible for the material contained within the vial of "ESRalpha, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.