Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197312_WB13.jpg WB (Western Blot) (WB Suggested Anti-ESRRB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Rabbit ESRRB Polyclonal Antibody | anti-ESRRB antibody

ESRRB antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ESRRB; ERR2; ERRb; ESRL2; NR3B2; DFNB35
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ESRRB, Antibody; ESRRB antibody - N-terminal region; anti-ESRRB antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS
Sequence Length
500
Applicable Applications for anti-ESRRB antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ESRRB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ESRRB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

product-image-AAA197312_WB13.jpg WB (Western Blot) (WB Suggested Anti-ESRRB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

WB (Western Blot)

(Sample Type: Mouse ES, fraction CV1Lanes :Lane 1: 25ug mouse ES cellsLane 2: 25ug mouse ES cells overexpressing DYKDDDDK EsrrB (mouse)Lane 3: 25ug chromatin fraction CV1 cellsLane 4: 25ug chromatin fraction CV1 cells overexpressing DYKDDDDK EsrrB (mouse)Lane 5: 25ug chromatin fraction CV1 cells overexpressing DYKDDDDK EsrrB-Deltacter (mouse)Primary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:3000Gene Name :ESRRBSubmitted by :Domenico Maiorano, Institute of Human Genetics (IGH))

product-image-AAA197312_WB15.jpg WB (Western Blot) (Sample Type: Mouse ES, fraction CV1Lanes :Lane 1: 25ug mouse ES cellsLane 2: 25ug mouse ES cells overexpressing DYKDDDDK EsrrB (mouse)Lane 3: 25ug chromatin fraction CV1 cellsLane 4: 25ug chromatin fraction CV1 cells overexpressing DYKDDDDK EsrrB (mouse)Lane 5: 25ug chromatin fraction CV1 cells overexpressing DYKDDDDK EsrrB-Deltacter (mouse)Primary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:3000Gene Name :ESRRBSubmitted by :Domenico Maiorano, Institute of Human Genetics (IGH))
Related Product Information for anti-ESRRB antibody
This is a rabbit polyclonal antibody against ESRRB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ESRRB encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. Sequence Note: The sequence AF094517.1 is from a chimeric clone. Only the ESRRB sequence was propagated into this RefSeq record. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
steroid hormone receptor ERR2
NCBI Official Synonym Full Names
estrogen related receptor beta
NCBI Official Symbol
ESRRB
NCBI Official Synonym Symbols
ERR2; ERRb; ESRL2; NR3B2; DFNB35
NCBI Protein Information
steroid hormone receptor ERR2
UniProt Protein Name
Steroid hormone receptor ERR2
UniProt Gene Name
ESRRB
UniProt Synonym Gene Names
ERRB2; ESRL2; NR3B2; ERR-beta
UniProt Entry Name
ERR2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ESRRB esrrb (Catalog #AAA197312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESRRB antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ESRRB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ESRRB esrrb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSDASGGFGL ALGTHANGLD SPPMFAGAGL GGTPCRKSYE DCASGIMEDS. It is sometimes possible for the material contained within the vial of "ESRRB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.