Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281007_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of Jurkat cells using 1ug ETS1 antibody. Western blot was performed from the immunoprecipitate using ETS1 antibody at a dilition of 1:1000.)

Rabbit anti-Human, Mouse ETS1 Polyclonal Antibody | anti-ETS1 antibody

ETS1 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
ETS1; p54; ETS-1; EWSR2; c-ets-1
Reactivity
Human, Mouse
Applications
Immunoprecipitation, Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
ETS1, Antibody; ETS1 Polyclonal Antibody; c-ets-1; ETS-1; EWSR2; p54; anti-ETS1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESI
Sequence Length
485
Applicable Applications for anti-ETS1 antibody
IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human ETS1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 200ug extracts of Jurkat cells using 1ug ETS1 antibody. Western blot was performed from the immunoprecipitate using ETS1 antibody at a dilition of 1:1000.)

product-image-AAA281007_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of Jurkat cells using 1ug ETS1 antibody. Western blot was performed from the immunoprecipitate using ETS1 antibody at a dilition of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using ETS1 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA281007_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using ETS1 antibody. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ETS1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA281007_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ETS1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-ETS1 antibody
This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-ETS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 25kDa; 30kDa; 40kDa; 50kDa; 55kDa
Observed: 55kDa
NCBI Official Full Name
protein C-ets-1 isoform 1
NCBI Official Synonym Full Names
ETS proto-oncogene 1, transcription factor
NCBI Official Symbol
ETS1
NCBI Official Synonym Symbols
p54; ETS-1; EWSR2; c-ets-1
NCBI Protein Information
protein C-ets-1
UniProt Protein Name
Protein C-ets-1
UniProt Gene Name
ETS1
UniProt Synonym Gene Names
EWSR2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ETS1 ets1 (Catalog #AAA281007) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ETS1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ETS1 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the ETS1 ets1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKAAVDLKPT LTIIKTEKVD LELFPSPDME CADVPLLTPS SKEMMSQALK ATFSGFTKEQ QRLGIPKDPR QWTETHVRDW VMWAVNEFSL KGVDFQKFCM NGAALCALGK DCFLELAPDF VGDILWEHLE ILQKEDVKPY QVNGVNPAYP ESRYTSDYFI SYGIEHAQCV PPSEFSEPSF ITESYQTLHP ISSEELLSLK YENDYPSVIL RDPLQTDTLQ NDYFAIKQEV VTPDNMCMGR TSRGKLGGQD SFESI. It is sometimes possible for the material contained within the vial of "ETS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.