Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198350_WB10.jpg WB (Western Blot) (Host: RabbitTarget: ETS2Positive control (+): Mouse Kidney (M-KI)Negative control (-): Mouse Testis (M-TE)Antibody concentration: 1ug/ml)

Rabbit ETS2 Polyclonal Antibody | anti-ETS2 antibody

ETS2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ETS2; ETS2IT1
Reactivity
Tested: Human, Mouse
Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ETS2, Antibody; ETS2 antibody - middle region; anti-ETS2 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human, Mouse
Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: DPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC
Sequence Length
469
Applicable Applications for anti-ETS2 antibody
WB (Western Blot)
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ETS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget: ETS2Positive control (+): Mouse Kidney (M-KI)Negative control (-): Mouse Testis (M-TE)Antibody concentration: 1ug/ml)

product-image-AAA198350_WB10.jpg WB (Western Blot) (Host: RabbitTarget: ETS2Positive control (+): Mouse Kidney (M-KI)Negative control (-): Mouse Testis (M-TE)Antibody concentration: 1ug/ml)

WB (Western Blot)

(WB Suggested Anti-ETS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)

product-image-AAA198350_WB11.jpg WB (Western Blot) (WB Suggested Anti-ETS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)

WB (Western Blot)

(Host: MouseTarget Name: ETS2Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA198350_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: ETS2Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

WB (Western Blot)

(ETS2 antibody - middle region validated by WB using human LCL and mouse brains at 1:1000.)

product-image-AAA198350_WB15.jpg WB (Western Blot) (ETS2 antibody - middle region validated by WB using human LCL and mouse brains at 1:1000.)
Related Product Information for anti-ETS2 antibody
This is a rabbit polyclonal antibody against ETS2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ETS2 contains an ETS DNA-binding domain and belongs to the ETS family. ETS2 is a target of protein kinase C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly associated with the rate of recurrence and HER expression in breast cancer. Overexpression of ETS2 is associated with human esophageal squamous cell carcinoma. ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
protein C-ets-2 isoform 1
NCBI Official Synonym Full Names
ETS proto-oncogene 2, transcription factor
NCBI Official Symbol
ETS2
NCBI Official Synonym Symbols
ETS2IT1
NCBI Protein Information
protein C-ets-2
UniProt Protein Name
Protein C-ets-2
UniProt Gene Name
ETS2
UniProt Entry Name
ETS2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ETS2 ets2 (Catalog #AAA198350) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ETS2 antibody - middle region reacts with Tested: Human, Mouse Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ETS2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ETS2 ets2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPDEVARRWG KRKNKPKMNY EKLSRGLRYY YDKNIIHKTS GKRYVYRFVC. It is sometimes possible for the material contained within the vial of "ETS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.