Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281008_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using ETV1 antibody.)

Rabbit ETV1 Polyclonal Antibody | anti-ETV1 antibody

ETV1 Polyclonal Antibody

Gene Names
ETV1; ER81
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry
Purity
Affinity Purification
Synonyms
ETV1, Antibody; ETV1 Polyclonal Antibody; ER81; anti-ETV1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
AFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQ
Sequence Length
454
Applicable Applications for anti-ETV1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry)
Immunogen
Recombinant protein of human ETV1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of A549 cells using ETV1 antibody.)

product-image-AAA281008_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using ETV1 antibody.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse pancreas using ETV1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281008_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse pancreas using ETV1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human breast cancer using ETV1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281008_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human breast cancer using ETV1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat pancreas using ETV1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281008_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat pancreas using ETV1 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-ETV1 antibody
This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS proteins contain an ETS DNA-binding domain that binds to DNA sequences containing the consensus 5'-CGGA[AT]-3'. The protein encoded by this gene contains a conserved short acidic transactivation domain (TAD) in the N-terminal region, in addition to the ETS DNA-binding domain in the C-terminal region. This gene is involved in chromosomal translocations, which result in multiple fusion proteins including EWS-ETV1 in Ewing sarcoma and at least 10 ETV1 partners (see PMID: 19657377, Table 1) in prostate cancer. In addition to chromosomal rearrangement, this gene is overexpressed in prostate cancer, melanoma and gastrointestinal stromal tumor. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-ETV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43kDa/48kDa/50kDa/52kDa/53kDa/55kDa
NCBI Official Full Name
ETS translocation variant 1 isoform b
NCBI Official Synonym Full Names
ETS variant 1
NCBI Official Symbol
ETV1
NCBI Official Synonym Symbols
ER81
NCBI Protein Information
ETS translocation variant 1
UniProt Protein Name
ETS translocation variant 1
UniProt Gene Name
ETV1
UniProt Synonym Gene Names
ER81

Similar Products

Product Notes

The ETV1 etv1 (Catalog #AAA281008) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ETV1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ETV1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ETV1 etv1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AFHGLPLKIK KEPHSPCSEI SSACSQEQPF KFSYGEKCLY NVSAYDQKPQ VGMRPSNPPT PSSTPVSPLH HASPNSTHTP KPDRAFPAHL PPSQSIPDSS YPMDHRFRRQ LSEPCNSFPP LPTMPREGRP MYQRQMSEPN IPFPPQGFKQ EYHDPVYEHN TMVGSAASQS FPPPLMIKQE PRDFAYDSEV PSCHSIYMRQ EGFLAHPSRT EGCMFEKGPR Q. It is sometimes possible for the material contained within the vial of "ETV1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.