Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224269_WB13.jpg WB (Western Blot) (Lane1: E Coli purified Exd (no tag) Lane2: Cell free expressed Exd (His tag) Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000)

Rabbit EXD Polyclonal Antibody | anti-EXD antibody

EXD antibody

Average rating 0.0
No ratings yet
Reactivity
Drosophila, melanogaster
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
EXD, Antibody; EXD antibody; Polyclonal EXD; Anti-EXD; td48; Dm-EXD; DExd; unnamed; CG8933; EXD; Dpbx; Dmel_CG8933; anti-EXD antibody
Ordering
Host
Rabbit
Reactivity
Drosophila, melanogaster
Clonality
Polyclonal
Specificity
EXD antibody was raised against the C terminal Of Exd
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of EXD antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-EXD antibody
WB (Western Blot)
Biological Significance
As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.
Cross-Reactivity
Drosophila,melanogaster
Immunogen
EXD antibody was raised using the C terminal Of Exd corresponding to a region with amino acids EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

WB (Western Blot)

(Lane1: E Coli purified Exd (no tag) Lane2: Cell free expressed Exd (His tag) Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000)

product-image-AAA224269_WB13.jpg WB (Western Blot) (Lane1: E Coli purified Exd (no tag) Lane2: Cell free expressed Exd (His tag) Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit HRP Secondary Antibody Dilution: 1:5000)

WB (Western Blot)

(Recommended exd Antibody Titration: 5.0ug/ml)

product-image-AAA224269_WB15.jpg WB (Western Blot) (Recommended exd Antibody Titration: 5.0ug/ml)
Related Product Information for anti-EXD antibody
Rabbit polyclonal EXD antibody raised against the C terminal Of Exd
Product Categories/Family for anti-EXD antibody

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EXD (Catalog #AAA224269) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EXD antibody reacts with Drosophila, melanogaster and may cross-react with other species as described in the data sheet. AAA Biotech's EXD can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the EXD for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EXD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.