WB (Western Blot)
(WB Suggested Anti-EXOSC4 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Rabbit EXOSC4 Polyclonal Antibody | anti-EXOSC4 antibody
EXOSC4 antibody - N-terminal region
Gene Names
EXOSC4; SKI6; p12A; RRP41; Ski6p; RRP41A; Rrp41p; hRrp41p
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
EXOSC4, Antibody; EXOSC4 antibody - N-terminal region; anti-EXOSC4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE
Sequence Length
245
Applicable Applications for anti-EXOSC4 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EXOSC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-EXOSC4 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-EXOSC4 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
IHC (Immunohiostchemistry)
(Rabbit Anti-EXOSC4 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohiostchemistry)
(Rabbit Anti-EXOSC4 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-EXOSC4 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-EXOSC4 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-EXOSC4 antibody
This is a rabbit polyclonal antibody against EXOSC4. It was validated on Western Blot and immunohistochemistry
Target Description: EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.
Target Description: EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.
Product Categories/Family for anti-EXOSC4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
exosome complex component RRP41
NCBI Official Synonym Full Names
exosome component 4
NCBI Official Symbol
EXOSC4
NCBI Official Synonym Symbols
SKI6; p12A; RRP41; Ski6p; RRP41A; Rrp41p; hRrp41p
NCBI Protein Information
exosome complex component RRP41
UniProt Protein Name
Exosome complex component RRP41
UniProt Gene Name
EXOSC4
UniProt Synonym Gene Names
RRP41; SKI6
UniProt Entry Name
EXOS4_HUMAN
Similar Products
Product Notes
The EXOSC4 exosc4 (Catalog #AAA198792) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EXOSC4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EXOSC4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the EXOSC4 exosc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDQGYRVDGR RAGELRKIQA RMGVFAQADG SAYIEQGNTK ALAVVYGPHE. It is sometimes possible for the material contained within the vial of "EXOSC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.