Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198820_WB11.jpg WB (Western Blot) (WB Suggested Anti-EXOSC6 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit EXOSC6 Polyclonal Antibody | anti-EXOSC6 antibody

EXOSC6 antibody - N-terminal region

Gene Names
EXOSC6; p11; EAP4; MTR3; Mtr3p; hMtr3p
Reactivity
Cow, Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
EXOSC6, Antibody; EXOSC6 antibody - N-terminal region; anti-EXOSC6 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK
Sequence Length
272
Applicable Applications for anti-EXOSC6 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Human: 100%; Mouse: 88%; Pig: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EXOSC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EXOSC6 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA198820_WB11.jpg WB (Western Blot) (WB Suggested Anti-EXOSC6 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohiostchemistry)

(Rabbit Anti-EXOSC6 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198820_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-EXOSC6 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-EXOSC6 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198820_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-EXOSC6 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-EXOSC6 antibody
This is a rabbit polyclonal antibody against EXOSC6. It was validated on Western Blot and immunohistochemistry

Target Description: EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation.This gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
exosome complex component MTR3
NCBI Official Synonym Full Names
exosome component 6
NCBI Official Symbol
EXOSC6
NCBI Official Synonym Symbols
p11; EAP4; MTR3; Mtr3p; hMtr3p
NCBI Protein Information
exosome complex component MTR3
UniProt Protein Name
Exosome complex component MTR3
UniProt Gene Name
EXOSC6
UniProt Synonym Gene Names
MTR3; hMtr3
UniProt Entry Name
EXOS6_HUMAN

Similar Products

Product Notes

The EXOSC6 exosc6 (Catalog #AAA198820) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EXOSC6 antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EXOSC6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the EXOSC6 exosc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPGDHRRIRG PEESQPPQLY AADEEEAPGT RDPTRLRPVY ARAGLLSQAK. It is sometimes possible for the material contained within the vial of "EXOSC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.