Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA23409_WB8.jpg WB (Western Blot) (WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Rabbit EYA1 Polyclonal Antibody | anti-EYA1 antibody

EYA1 antibody - middle region

Gene Names
EYA1; BOP; BOR; BOS1; OFC1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
EYA1, Antibody; EYA1 antibody - middle region; anti-EYA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP
Sequence Length
592
Applicable Applications for anti-EYA1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EYA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

product-image-AAA23409_WB8.jpg WB (Western Blot) (WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

WB (Western Blot)

(Host: RabbitTarget Name: EYA1Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23409_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: EYA1Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EYA1Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23409_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: EYA1Sample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EYA1Sample Tissue: Human PC-3 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23409_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: EYA1Sample Tissue: Human PC-3 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EYA1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23409_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: EYA1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EYA1Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23409_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: EYA1Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EYA1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23409_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: EYA1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-EYA1 antibody)

product-image-AAA23409_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-EYA1 antibody)
Related Product Information for anti-EYA1 antibody
This is a rabbit polyclonal antibody against EYA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EYA1 is a member of the eyes absent (EYA) family of proteins. EYA1 may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator.This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator. Four transcript variants encoding three distinct isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Synonym Full Names
EYA transcriptional coactivator and phosphatase 1
NCBI Official Symbol
EYA1
NCBI Official Synonym Symbols
BOP; BOR; BOS1; OFC1
NCBI Protein Information
eyes absent homolog 1
UniProt Protein Name
Eyes absent homolog 1
UniProt Gene Name
EYA1
UniProt Entry Name
EYA1_HUMAN

Similar Products

Product Notes

The EYA1 eya1 (Catalog #AAA23409) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EYA1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EYA1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the EYA1 eya1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDYPSYPSFG QGQYAQYYNS SPYPAHYMTS SNTSPTTPST NATYQLQEPP. It is sometimes possible for the material contained within the vial of "EYA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.