Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198321_WB13.jpg WB (Western Blot) (WB Suggested Anti-EZH2 Antibody Titration: 1.0ug/mlPositive Control: MCF7 cell lysateEZH2 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit EZH2 Polyclonal Antibody | anti-EZH2 antibody

EZH2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
EZH2; WVS; ENX1; KMT6; WVS2; ENX-1; EZH2b; KMT6A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
EZH2, Antibody; EZH2 antibody - N-terminal region; anti-EZH2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Specificity
From peptide immunogen, will recognize all 5 isoforms.
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQE
Sequence Length
751
Applicable Applications for anti-EZH2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EZH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EZH2 Antibody Titration: 1.0ug/mlPositive Control: MCF7 cell lysateEZH2 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA198321_WB13.jpg WB (Western Blot) (WB Suggested Anti-EZH2 Antibody Titration: 1.0ug/mlPositive Control: MCF7 cell lysateEZH2 is supported by BioGPS gene expression data to be expressed in MCF7)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA198321_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-EZH2 antibody
This is a rabbit polyclonal antibody against EZH2. It was validated on Western Blot and immunohistochemistry

Target Description: EZH2 is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
histone-lysine N-methyltransferase EZH2 isoform a
NCBI Official Synonym Full Names
enhancer of zeste 2 polycomb repressive complex 2 subunit
NCBI Official Symbol
EZH2
NCBI Official Synonym Symbols
WVS; ENX1; KMT6; WVS2; ENX-1; EZH2b; KMT6A
NCBI Protein Information
histone-lysine N-methyltransferase EZH2
UniProt Protein Name
Histone-lysine N-methyltransferase EZH2
UniProt Gene Name
EZH2
UniProt Synonym Gene Names
KMT6
UniProt Entry Name
EZH2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The EZH2 ezh2 (Catalog #AAA198321) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EZH2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EZH2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the EZH2 ezh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KGPVCWRKRV KSEYMRLRQL KRFRRADEVK SMFSSNRQKI LERTEILNQE. It is sometimes possible for the material contained within the vial of "EZH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.