Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200984_WB11.jpg WB (Western Blot) (WB Suggested Anti-F8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Rabbit F8 Polyclonal Antibody | anti-F8 antibody

F8 antibody - C-terminal region

Gene Names
F8; AHF; F8B; F8C; HEMA; FVIII; DXS1253E
Reactivity
Cow, Dog, Horse, Human, Rabbit, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
F8, Antibody; F8 antibody - C-terminal region; anti-F8 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ
Sequence Length
2351
Applicable Applications for anti-F8 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 77%; Horse: 93%; Human: 100%; Rabbit: 86%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human F8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-F8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

product-image-AAA200984_WB11.jpg WB (Western Blot) (WB Suggested Anti-F8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: F8Sample Type: 721_B Whole CellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)

product-image-AAA200984_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: F8Sample Type: 721_B Whole CellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)

WB (Western Blot)

(Host: RabbitTarget Name: F8Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

product-image-AAA200984_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: F8Sample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)
Related Product Information for anti-F8 antibody
This is a rabbit polyclonal antibody against F8. It was validated on Western Blot

Target Description: This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder.
Product Categories/Family for anti-F8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79kDa
NCBI Official Full Name
coagulation factor VIII isoform a preproprotein
NCBI Official Synonym Full Names
coagulation factor VIII
NCBI Official Symbol
F8
NCBI Official Synonym Symbols
AHF; F8B; F8C; HEMA; FVIII; DXS1253E
NCBI Protein Information
coagulation factor VIII
UniProt Protein Name
Coagulation factor VIII
UniProt Gene Name
F8
UniProt Synonym Gene Names
F8C; AHF
UniProt Entry Name
FA8_HUMAN

Similar Products

Product Notes

The F8 f8 (Catalog #AAA200984) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The F8 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's F8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the F8 f8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IMVTFRNQAS RPYSFYSSLI SYEEDQRQGA EPRKNFVKPN ETKTYFWKVQ. It is sometimes possible for the material contained within the vial of "F8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.