Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46488_IHC11.jpg IHC (Immunohistochemisry) (Anti- FABP4 antibody, IHC(P)IHC(P): Rat Intestine Tissue)

FABP4 Polyclonal Antibody | anti-FABP4 antibody

Anti-FABP4 Antibody

Average rating 0.0
No ratings yet
Gene Names
FABP4; aP2; ALBP; AFABP; A-FABP; HEL-S-104
Reactivity
Mouse, Rat
Predicted to work with: Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
FABP4, Antibody; Anti-FABP4 Antibody; Fatty acid-binding protein; 3T3-L1 lipid-binding protein; 422/aP2; A FABP; A-FABP; adipocyte; Adipocyte lipid binding protein; Adipocyte lipid-binding protein; Adipocyte protein AP2; Adipocyte-type fatty acid-binding protein; AFABP; ALBP; ALBP/Ap2; aP2; FABP; FABP4; FABP4_HUMAN; Fatty acid binding protein 4 adipocyte; Fatty acid binding protein 4; Fatty acid binding protein adipocyte; Fatty acid-binding protein 4; Lbpl; Myelin P2 protein homolog; P15; P2 adipocyte protein; Protein 422 antibody; fatty acid binding protein 4, adipocyte; anti-FABP4 antibody
Ordering
Reactivity
Mouse, Rat
Predicted to work with: Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
132
Applicable Applications for anti-FABP4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Anti- FABP4 antibody, IHC(P)IHC(P): Rat Intestine Tissue)

product-image-AAA46488_IHC11.jpg IHC (Immunohistochemisry) (Anti- FABP4 antibody, IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- FABP4 antibody, IHC(P)IHC(P): Mouse Intestine Tissue)

product-image-AAA46488_IHC13.jpg IHC (Immunohiostchemistry) (Anti- FABP4 antibody, IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- FABP4 antibody, Western blottingAll lanes: Anti FABP4 at 0.5ug/ml)

product-image-AAA46488_WB15.jpg WB (Western Blot) (Anti- FABP4 antibody, Western blottingAll lanes: Anti FABP4 at 0.5ug/ml)
Related Product Information for anti-FABP4 antibody
Description: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, adipocyte(FABP4) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.
References
1. Hotamisligil, G. S.; Johnson, R. S.; Distel, R. J.; Ellis, R.; Papaioannou, V. E.; Spiegelman, B. M. : Uncoupling of obesity from insulin resistance through a targeted mutation in aP2, the adipocyte fatty acid binding protein. Science 274: 1377-1379, 1996. 2. Furuhashi, M.; Tuncman, G.; Gorgun, C. Z.; Makowski, L.; Atsumi, G.; Vaillancourt, E.; Kono, K.; Babaev, V. R.; Fazio, S.; Linton, M. F.; Sulsky, R.; Robl, J. A.; Parker, R. A.; Hotamisligil, G. S. : Treatment of diabetes and atherosclerosis by inhibiting fatty-acid-binding protein aP2. Nature 447: 959-965, 2007. 3. Shum, B. O. V.; Mackay, C. R.; Gorgun, C. Z.; Frost, M. J.; Kumar, R. K.; Hotamisligil, G. S.; Rolph, M. S. : The adipocyte fatty acid-binding protein aP2 is required in allergic airway inflammation. J. Clin. Invest. 116: 2183-2192, 2006.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,719 Da
NCBI Official Full Name
fatty acid-binding protein, adipocyte
NCBI Official Synonym Full Names
fatty acid binding protein 4
NCBI Official Symbol
FABP4
NCBI Official Synonym Symbols
aP2; ALBP; AFABP; A-FABP; HEL-S-104
NCBI Protein Information
fatty acid-binding protein, adipocyte
UniProt Protein Name
Fatty acid-binding protein, adipocyte
UniProt Gene Name
FABP4
UniProt Synonym Gene Names
ALBP; A-FABP; AFABP
UniProt Entry Name
FABP4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FABP4 fabp4 (Catalog #AAA46488) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-FABP4 Antibody reacts with Mouse, Rat Predicted to work with: Human and may cross-react with other species as described in the data sheet. AAA Biotech's FABP4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FABP4 fabp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FABP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.