Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197702_WB11.jpg WB (Western Blot) (WB Suggested Anti-FABP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit FABP4 Polyclonal Antibody | anti-FABP4 antibody

FABP4 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
FABP4; aP2; ALBP; AFABP; A-FABP; HEL-S-104
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FABP4, Antibody; FABP4 antibody - middle region; anti-FABP4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
Sequence Length
132
Applicable Applications for anti-FABP4 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 85%; Dog: 92%; Goat: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%; Sheep: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FABP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FABP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

product-image-AAA197702_WB11.jpg WB (Western Blot) (WB Suggested Anti-FABP4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

WB (Western Blot)

(Host: RabbitTarget Name: FABP4Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

product-image-AAA197702_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: FABP4Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Human brainBrain, cortex)

product-image-AAA197702_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human brainBrain, cortex)
Related Product Information for anti-FABP4 antibody
This is a rabbit polyclonal antibody against FABP4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
fatty acid-binding protein, adipocyte
NCBI Official Synonym Full Names
fatty acid binding protein 4
NCBI Official Symbol
FABP4
NCBI Official Synonym Symbols
aP2; ALBP; AFABP; A-FABP; HEL-S-104
NCBI Protein Information
fatty acid-binding protein, adipocyte
UniProt Protein Name
Fatty acid-binding protein, adipocyte
UniProt Gene Name
FABP4
UniProt Synonym Gene Names
ALBP; A-FABP; AFABP
UniProt Entry Name
FABP4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FABP4 fabp4 (Catalog #AAA197702) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FABP4 antibody - middle region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's FABP4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FABP4 fabp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FDEVTADDRK VKSTITLDGG VLVHVQKWDG KSTTIKRKRE DDKLVVECVM. It is sometimes possible for the material contained within the vial of "FABP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.